DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and sit

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster


Alignment Length:265 Identity:99/265 - (37%)
Similarity:151/265 - (56%) Gaps:15/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFTLLDLFRGLPADPVHLPMF--GTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNF 64
            ||...||     |||.....|  .:|||.:.|:..||..:...||.||:.|||:.:.:.:|:|||
  Fly    13 NFLFTDL-----ADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNF 72

  Fly    65 CQVLMNSGIFLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLR 129
            .||.::..:...|   :.|.:.|.:||..:..|..|....:..:.|.|::.|:.:|:||||||||
  Fly    73 FQVALSVWMVYEG---VVIWQYYSWRCQPVDWSRTPKAYREARVVYVYYLAKITELLDTIFFVLR 134

  Fly   130 KSNKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTF 194
            |:::|:|.||||||..|.:....|..:| |||....:|::|||||::||:|||.||:.|.::...
  Fly   135 KNDRQVTFLHVYHHTVMPMISWGTSKYY-PGGHGTFIGWINSFVHIIMYSYYFLSAFGPQMQKYL 198

  Fly   195 WWKEYITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVK--A 257
            |||:|||.||.:||...|......|:.:  |.:|:......|..:|....:|.:||.::|.|  |
  Fly   199 WWKKYITNLQMIQFCCAFIHQTQLLYTD--CGYPRWSVCFTLPNAVFFYFLFNDFYQKSYKKKQA 261

  Fly   258 KSKEQ 262
            .:||:
  Fly   262 AAKEK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 91/245 (37%)
sitNP_651063.1 ELO 28..252 CDD:279492 85/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449592
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.