DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster


Alignment Length:254 Identity:83/254 - (32%)
Similarity:132/254 - (51%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF--------LM 76
            |:..:|.|.|.|.|.|..::..:||..|.:|||:.:||.:::||..||:.::.:|        |.
  Fly    27 PLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYESCIGGWLN 91

  Fly    77 GTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVY 141
            |         |:.||..:..|..|.........::|:.:|..:..||.|||:||...|::.|||.
  Fly    92 G---------YNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVI 147

  Fly   142 HHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKL 203
            ||..|    |::.::   :.|||.....|:||:|||:.|||||..:|..|.|:...|||:|:|.:
  Fly   148 HHGIM----PVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVM 208

  Fly   204 QFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKEQ 262
            |.:||:::...| ..|:....|.:|....|.....:|....:|.|||.:.|||...|::
  Fly   209 QMIQFVLVMVHS-FQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 83/252 (33%)
ELOVLNP_649754.1 ELO 27..266 CDD:366492 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449617
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.