DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl1b

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001315523.1 Gene:elovl1b / 406725 ZFINID:ZDB-GENE-040426-2755 Length:320 Species:Danio rerio


Alignment Length:248 Identity:89/248 - (35%)
Similarity:135/248 - (54%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGI---FLMGTYYL 81
            |:..:|.....|:|.||..:...||.||.:|||:.:::||:|||...|.:::.|   |||..:  
Zfish    28 PLMESPFSMTAILLAYLFFVLYAGPKFMANRKPFQLKEAMIIYNLSLVGLSAYIVYEFLMSGW-- 90

  Fly    82 FIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFM 146
              ...|.:||.....|:.|.......:.:.:..:|.|:|:||:||||||.:.|||.||::||.||
Zfish    91 --ATGYTWRCDPCDYSNSPQGLRMARVAWLFLFSKFIELMDTVFFVLRKKHSQITFLHIFHHSFM 153

  Fly   147 VLGVPLTYYFYG----PGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQ 207
                |.|:: :|    |||..:....:||.|||:||.||..||..|..:...|||:|:|.:|..|
Zfish   154 ----PWTWW-WGVSIVPGGMGSFHAMVNSCVHVIMYFYYGLSAAGPRFQKFLWWKKYMTAIQLTQ 213

  Fly   208 FMILFAQSVLTLWLNPGCRF--PKVLQYVQLGGSVSMMTMFGNFYYQTYVKAK 258
            | :|.:..|...:....|.|  |.::..:.|.|:. ...:|.||:||.|:|.|
Zfish   214 F-VLVSLHVSQWYFMESCDFQVPVIIHLIWLYGTF-FFVLFSNFWYQAYIKGK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 89/248 (36%)
elovl1bNP_001315523.1 ELO 28..268 CDD:279492 89/248 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.