DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and CG31522

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:139/269 - (51%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTYYL 81
            ||..:|.|.:.:.|.|:.|:..:||..|.:|||.|::..:::||..||:.::.:|   |||.:: 
  Fly    27 PMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWW- 90

  Fly    82 FIKKLYDFRCMTMLSSDHPD------------------KDVD--------RLL--TYFYFINKVI 118
               ..|.|||..:..:|.|.                  :.||        |::  .::|:.:|..
  Fly    91 ---GSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFT 152

  Fly   119 DLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAY 180
            :.:|||||||||.:.|:|.|||.||..|    |::.:|   :.|||.....|.||:|||:|||.|
  Fly   153 EFMDTIFFVLRKKSSQVTTLHVIHHGCM----PMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTY 213

  Fly   181 YFASAWYPNVKSTFWWKEYITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTM 245
            |..||..|..:...|||:|:|.||.:||:::...:...|:::  |.:||...:.....:|....:
  Fly   214 YMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFID--CNYPKAFVWWIGMHAVMFFFL 276

  Fly   246 FGNFYYQTY 254
            |..||...|
  Fly   277 FNEFYKAAY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 87/269 (32%)
CG31522NP_001262254.1 ELO 27..293 CDD:279492 87/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449616
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.