DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and CG32071

DIOPT Version :10

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729667.1 Gene:CG32071 / 39246 FlyBaseID:FBgn0052071 Length:150 Species:Drosophila melanogaster


Alignment Length:177 Identity:37/177 - (20%)
Similarity:60/177 - (33%) Gaps:68/177 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 KLEKAPQETYADIG------------GLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGP 225
            ::.|.|..|.:.|.            ||...|.::.:.|          |:..:|.    :|.|.
  Fly   186 RISKVPVRTLSTINSATGENAFFGAYGLKPAINDVTKLV----------EDFSLKS----LLEGS 236

  Fly   226 ---PGTGKTLLAKAVANQTSATFLRVV-----------------GSEL---IQKYLGDGPKLVRE 267
               |..||..:.|  :..|:.|.|.||                 .:||   :.:.||..|..:..
  Fly   237 YECPSLGKDKMKK--SENTNNTLLSVVKNVWSILPTKRPVQSQSSTELDTCLSRTLGSPPSSISA 299

  Fly   268 LFRVAEEHAPSIVFIDEIDAV------GTKRYDSNSGGEREIQRTML 308
            ..       |:...||:::|:      .:|.:..||    ||..|.|
  Fly   300 TL-------PNSENIDKVNALDGDLSSSSKDHCINS----EIPSTPL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:460083 25/123 (20%)
CG32071NP_729667.1 None

Return to query results.
Submit another query.