DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl7

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:262 Identity:89/262 - (33%)
Similarity:139/262 - (53%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADP--VHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGI--- 73
            |||  .:..:..:|||..:|:..|:..:..:||..|.:|||:.::|||:.|||..||.:..:   
  Rat    21 ADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYE 85

  Fly    74 FLM---GTYYLFIKKLYDF----RCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKS 131
            |:|   ||.|.|...:.|:    |.|.|:.:           .:.|:.:|.|:|.|||||||||.
  Rat    86 FVMSGWGTGYSFRCDIVDYSQSPRAMRMVHT-----------CWLYYFSKFIELFDTIFFVLRKK 139

  Fly   132 NKQITVLHVYHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKST 193
            |.|:|.|||:||..|    |.|::|   :..||.......||:.||||||.||...|..|..:..
  Rat   140 NSQVTFLHVFHHTIM----PWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKY 200

  Fly   194 FWWKEYITKLQFLQFMILFAQSVLTLWLNPGC--RFPKVLQYVQLGGSVSMMTMFGNFYYQTYVK 256
            .|||:::|.||.:|| :|....:..::....|  ::|..|..:...|.:.:: :|.:|:|:.|.|
  Rat   201 LWWKKHLTSLQLVQF-VLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLL-LFLHFWYRAYTK 263

  Fly   257 AK 258
            .:
  Rat   264 GQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 86/254 (34%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 86/253 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.