DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl4b

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_956266.1 Gene:elovl4b / 335732 ZFINID:ZDB-GENE-030131-7672 Length:303 Species:Danio rerio


Alignment Length:251 Identity:86/251 - (34%)
Similarity:146/251 - (58%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIK 84
            ||..:|||.:.|.:.|||.:: .||.:|::|:|:.:||.:::|||..||:|        :|: .|
Zfish    30 PMMSSPLPTLGISVLYLLFLW-AGPLYMQNREPFQLRKTLIVYNFSMVLLN--------FYI-CK 84

  Fly    85 KL--------YDFRCMTMLSSDHPDKDVDRL----LTYFYFINKVIDLIDTIFFVLRKSNKQITV 137
            :|        |.:.|..:..|:    ||:.:    ..::|:|:|.::.:||:||::||...|::.
Zfish    85 ELLLGSRAAGYSYLCQPVNYSN----DVNEVRIASALWWYYISKGVEFLDTVFFIMRKKFNQVSF 145

  Fly   138 LHVYHHVFMV----LGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKE 198
            ||||||..|.    :|:.     :.||||......:||.:||:||.||..:|:.|.::...|||:
Zfish   146 LHVYHHCTMFILWWIGIK-----WVPGGQSFFGATINSGIHVLMYGYYGLAAFGPKIQKYLWWKK 205

  Fly   199 YITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTY 254
            |:|.:|.:||.:....:..:|:  .||.||..:|:..:|.:|:.:.:|.|||||||
Zfish   206 YLTIIQMIQFHVTIGHAAHSLY--TGCPFPAWMQWALIGYAVTFIILFANFYYQTY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 86/251 (34%)
elovl4bNP_956266.1 ELO 30..266 CDD:279492 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.