DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and CG31141

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:258 Identity:110/258 - (42%)
Similarity:160/258 - (62%) Gaps:7/258 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLDLFRGLPADPVHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLM 69
            :|::||...||...||:...|.|.|:|::||||::||.|..||..|:|||:||.:..||..|:..
  Fly     1 MLEIFRTPYADSKQLPLATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFY 65

  Fly    70 NSGIFLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQ 134
            |..:.|.|.|::.:.:.|:|||||:|..|||.|:.:|.::|.|:|||::||:||:|.||||...|
  Fly    66 NIMMLLPGYYFMLVFQPYNFRCMTVLQQDHPLKNWERCISYAYYINKIVDLLDTVFCVLRKKYSQ 130

  Fly   135 ITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVK-STFWWKE 198
            ||.|||:|||.|.....|...|||.|||...:...|.|||:.|||||:::     :| :|..||.
  Fly   131 ITFLHVFHHVLMPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSA-----IKGNTVRWKR 190

  Fly   199 YITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261
            |:|.:|.|||:::|....||. :...|...:...::....:..|..||.|||:|.|::.|.||
  Fly   191 YLTLMQMLQFLLMFGHCALTA-MQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYLRPKHKE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 104/243 (43%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 95/225 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449548
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1211.750

Return to query results.
Submit another query.