DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elo68alpha

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:127/269 - (47%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFTLLDLFRGLPADPVHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQ 66
            |:.|:|.|..:|                 ::|...||:.:..|.:....||..:|..:..::...
  Fly    21 NWPLVDSFWTVP-----------------VLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAM 68

  Fly    67 VLMNSGIFLMGTYYLFIKKL-YDFRCM-TMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLR 129
            |.:|..|.|  ..|...:.| |:|.|. ..:|.|..:..:.:...:|| |:|:::..||.||:||
  Fly    69 VFLNGYICL--ELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFY-ISKILEFADTAFFILR 130

  Fly   130 KSNKQITVLHVYHH--VFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKS 192
            :...|::.||||||  :|:...:.:.:.   |.|...:...:|||||::||.||..|...|.|:.
  Fly   131 QKWSQLSFLHVYHHSTMFVFCWILIKWM---PTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQR 192

  Fly   193 TFWWKEYITKLQFLQFMILFAQSVLTLW----LNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQT 253
            ..|||.|:|.||.:||.|:|      .|    |..||.:...:.......|:..:.|||.||.|.
  Fly   193 FLWWKRYLTGLQLVQFTIIF------FWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQK 251

  Fly   254 Y-VKAKSKE 261
            | |.|..|:
  Fly   252 YTVSAVGKK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 76/251 (30%)
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473084
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.