DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl4

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:252 Identity:90/252 - (35%)
Similarity:148/252 - (58%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTY-- 79
            |:..:|.|.:.|...|||.:: :||.:|:.|:|:.||..::||||..||:|..||   .||:|  
  Rat    41 PLMQSPWPTLSISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNA 104

  Fly    80 -YLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHH 143
             |.:|.:..|:      |:|..:..:...| ::||::|.::.:||:||:|||.|.|::.||||||
  Rat   105 GYSYICQSVDY------SNDVNEVRIAAAL-WWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHH 162

  Fly   144 VFMVLGVPLTYYFYG----PGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQ 204
            ..|     .|.::.|    .|||......:|||:||:||:||..:|:.|.::...|||.|:|.||
  Rat   163 CTM-----FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQ 222

  Fly   205 FLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261
            .:||.:....:.|:|:.:  |.|||.:.:..:..::|.:.:|.|||.:||.:.|..:
  Rat   223 LVQFHVTIGHTALSLYTD--CPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 90/252 (36%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 90/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.