DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and SPAC1639.01c

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_592859.3 Gene:SPAC1639.01c / 2543177 PomBaseID:SPAC1639.01c Length:365 Species:Schizosaccharomyces pombe


Alignment Length:257 Identity:71/257 - (27%)
Similarity:111/257 - (43%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKLYDF 89
            |:.|.:|:..|||::  ||...||:|:|..::|....||. ...:.|.|..:..:......:|..
pombe    73 PVVATIIISYYLLIL--VGGRIMRNRQPIRLQKIFQYYNL-TFSIASAILALLIFEQVAPAIYKH 134

  Fly    90 RCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTY 154
            .....:.::.........|.|..:|:|.::|.||.|.||||  |.:..||.|||     |.....
pombe   135 GFFFSICNEKAWTQPLVFLYYCAYISKFLELTDTFFLVLRK--KPLQFLHCYHH-----GATAVL 192

  Fly   155 YFYGPGGQYN---LMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQF-----MIL 211
            .:....|:.:   |:..:|..|||.||.||:..|....|.    ||:::|:.|.:||     .|.
pombe   193 VYTQIVGRTSISWLIIEINLLVHVTMYYYYYLVAKGIRVP----WKKWVTRFQIVQFFADLGFIY 253

  Fly   212 FA---QSVLTLWLNPGCR-----FPKVLQYVQLGGSVSMMTMFGNFYYQTY-----VKAKSK 260
            ||   :....|.....|.     .| :..:..|....|.:.:|..||:.||     :|.|:|
pombe   254 FAVYTEVAYRLKFYKACMGHCSGHP-LAAFCGLATISSYLVLFIVFYHNTYKKNAALKMKAK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 71/257 (28%)
SPAC1639.01cNP_592859.3 ELO 69..303 CDD:279492 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.