DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:270 Identity:75/270 - (27%)
Similarity:131/270 - (48%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PADPVHLPMFG-TPL----PAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSG 72
            |::..::|  | ||:    ..||.:..|.::|.. |...|.:|||...|:...::||...:::..
pombe    40 PSEFEYIP--GKTPMSQWSSVIVSITAYYVIILS-GRAIMTNRKPLKQRRLFQLHNFILTIISGA 101

  Fly    73 IFLMGTYYLFIKKLYD--FRCMTMLSSDHPDKDVDRLLTYFY--FINKVIDLIDTIFFVLRKSNK 133
            :..:....:|...:.:  |.|  :..|.|   ...||:|.:|  ::.|.::|:||:|..|:|  |
pombe   102 LLALLVEEVFRNYMRNGLFYC--VCDSRH---FTQRLVTLYYLNYLTKYLELMDTVFLFLKK--K 159

  Fly   134 QITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKE 198
            .:..||.|||....| :..|........|:.::| ||.:|||:||:|||.:|....|    |||:
pombe   160 PLAFLHCYHHGITAL-LCFTQLLGRTSVQWGVIG-LNLYVHVIMYSYYFLAACGRRV----WWKQ 218

  Fly   199 YITKLQFLQFMILFAQSVLTLWLNPGCR-FPKVLQYVQLGGSV-----------SMMTMFGNFYY 251
            ::|::|.:||::.........:.:...| ||.:.......||:           |.:.:|..||.
pombe   219 WVTRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYI 283

  Fly   252 QTYVKAKSKE 261
            .||:|..:|:
pombe   284 NTYIKRGAKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 74/263 (28%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.