DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elo-9

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_497086.1 Gene:elo-9 / 190207 WormBaseID:WBGene00001247 Length:286 Species:Caenorhabditis elegans


Alignment Length:227 Identity:64/227 - (28%)
Similarity:102/227 - (44%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FMRSRKPYNMRKAMLIYN-FCQVLMNSGIFLMGTYY---LFIKKLYDFRCMTMLSSDHPDKDVDR 106
            :|.||||.:||..:|.:| |..|....|.:..|..:   :|.:...|..|:.:    :| :....
 Worm    69 YMESRKPKSMRPLLLAWNGFLAVFSIMGTWRFGIEFYDAVFRRGFIDSICLAV----NP-RSPSA 128

  Fly   107 LLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHH-VFMVLGVPLTYYFYGPGGQYNLMGYLN 170
            .....:.::|:.:..||:|.||||  :.:..||.||| |.::|..........||..:..|.|| 
 Worm   129 FWACMFALSKIAEFGDTMFLVLRK--RPVIFLHWYHHAVVLILSWHAAIELTAPGRWFIFMNYL- 190

  Fly   171 SFVHVVMYAYY-FASAWY--PNVKSTFWWKEYITKLQFLQFMILFAQSVLTLWLNPG---CRFPK 229
              ||.:||.|| ..|..|  |.:.|.     .:|.||.||.:|..:.|.:.|:|...   |:...
 Worm   191 --VHSIMYTYYAITSIGYRLPKIVSM-----TVTFLQTLQMLIGVSISCIVLYLKLNGEMCQQSY 248

  Fly   230 VLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261
            ....:..|...|.:.:|.:|:...|:..|.|:
 Worm   249 DNLALSFGIYASFLVLFSSFFNNAYLVKKDKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 64/227 (28%)
elo-9NP_497086.1 ELO 44..274 CDD:279492 61/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.