DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elo-7

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:265 Identity:70/265 - (26%)
Similarity:117/265 - (44%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLF 82
            |..:|      :.:.:.|::|:|.: ..|||.|:|:.:..|:.::||    ..|...:.|::.:|
 Worm    65 HFGLF------VQMAIAYVILVFSI-KRFMRDREPFQLTTALRLWNF----FLSVFSIYGSWTMF 118

  Fly    83 --------IKKLYDFRCMTMLSSDHPDKDVDRLLTYFYF---INKVIDLIDTIFFVLRKSNKQIT 136
                    :..||...|..:  |:.|.:     ..|:.|   ::|.::.:||.|.||||  |.:.
 Worm   119 PFMVQQIRLYGLYGCGCEAL--SNLPSQ-----AEYWLFLTILSKAVEFVDTFFLVLRK--KPLI 174

  Fly   137 VLHVYHHVFMVLGVPLTYYFY-----GPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWW 196
            .||.|||:       .|:.|:     .|..|..:...:|.|||..||.|||..:.  |:|.....
 Worm   175 FLHWYHHM-------ATFVFFCSNYPTPSSQSRVGVIVNLFVHAFMYPYYFTRSM--NIKVPAKI 230

  Fly   197 KEYITKLQFLQFMILFAQSVL---TLWLNP-GCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKA 257
            ...:|.||..|||.......|   :|..|. .|..|..:.:.....|.|...:|.||:::.|::.
 Worm   231 SMAVTVLQLTQFMCFIYGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSYFVLFANFFHKAYLQR 295

  Fly   258 KSKEQ 262
            ..|.:
 Worm   296 GGKRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 69/261 (26%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.