DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elo-4

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_499056.1 Gene:elo-4 / 183367 WormBaseID:WBGene00001242 Length:291 Species:Caenorhabditis elegans


Alignment Length:281 Identity:68/281 - (24%)
Similarity:117/281 - (41%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PADPVHLPMFGTPL------PAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNS 71
            |.:.|..|.:.|.|      .:|.|.:.|.:|| ||...||.:|||:.::..::::|......: 
 Worm    34 PGEQVADPQYWTILFQKYWYHSITISVLYFILI-KVIQKFMENRKPFTLKYPLILWNGALAAFS- 96

  Fly    72 GIFLMGTYYLFIKKLYDFRC----MTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSN 132
               ::.|....|..|.....    .|:..|.:| .||....::.:.::|:::|.||:|.:|||  
 Worm    97 ---IIATLRFSIDPLRSLYAEGFYKTLCYSCNP-TDVAAFWSFAFALSKIVELGDTMFIILRK-- 155

  Fly   133 KQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMG----YLNSFVHVVMYAYYFASA-------W 186
            :.:..||.|||..:::      |....|.::...|    .:|.|.|.:||.||..||       |
 Worm   156 RPLIFLHYYHHAAVLI------YTVHSGAEHTAAGRFYILMNYFAHSLMYTYYTVSAMGYRLPKW 214

  Fly   187 YPNVKST-----------FWWKEYITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSV 240
            .....:|           ..|..|..|   .::.:...|||..|:|       ..:.|      |
 Worm   215 VSMTVTTVQTTQMLAGVGITWMVYKVK---TEYKLPCQQSVANLYL-------AFVIY------V 263

  Fly   241 SMMTMFGNFYYQTYVKAKSKE 261
            :...:|..|:.:.|:...||:
 Worm   264 TFAILFIQFFVKAYIIKSSKK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 66/274 (24%)
elo-4NP_499056.1 ELO 48..278 CDD:279492 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.