DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elo-1

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:268 Identity:71/268 - (26%)
Similarity:122/268 - (45%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FGTPLPAIVIVLGYLLLIFKVGPD-FMRSRKPYNMRKAMLIYNFC-----------------QVL 68
            |...:.|.::   |::::|  |.. |||:|:|:.:...:.|:||.                 ..:
 Worm    44 FDVTIQASIL---YMVVVF--GTKWFMRNRQPFQLTIPLNIWNFILAAFSIAGAVKMTPEFFGTI 103

  Fly    69 MNSGIFLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNK 133
            .|.||  :.:|.    |::||           .|..:....:.:..:|:.:|:||||.||||  :
 Worm   104 ANKGI--VASYC----KVFDF-----------TKGENGYWVWLFMASKLFELVDTIFLVLRK--R 149

  Fly   134 QITVLHVYHHVFMVLGVPLTYYFYG----PGGQYNLMG-YLNSFVHVVMYAYYFASAWYPNVKST 193
            .:..||.|||:..::     |.:|.    ||  :|..| |||..||..||:|||..:.  .::..
 Worm   150 PLMFLHWYHHILTMI-----YAWYSHPLTPG--FNRYGIYLNFVVHAFMYSYYFLRSM--KIRVP 205

  Fly   194 FWWKEYITKLQFLQFMI----LFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTY 254
            .:..:.||.||.:||:|    |.....|..:.|..|.|...:..:.:....:.:.:|.||:.|:|
 Worm   206 GFIAQAITSLQIVQFIISCAVLAHLGYLMHFTNANCDFEPSVFKLAVFMDTTYLALFVNFFLQSY 270

  Fly   255 VKAKSKEQ 262
            |....|::
 Worm   271 VLRGGKDK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 71/266 (27%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.