DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl5

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:254 Identity:92/254 - (36%)
Similarity:148/254 - (58%) Gaps:40/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKL---- 86
            :|..|....|||::: :||.:|::|:|::.|..:::||.       |:.|: :.|:|.:.:    
  Rat    33 IPTFVCSAIYLLIVW-LGPKYMKNRQPFSCRGILVVYNL-------GLTLL-SLYMFYELVTGVW 88

  Fly    87 ---YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHV---- 144
               |:|.|....|:...|..|.|:|.::|| :|:|:.:||.||:|||:|.||||||||||.    
  Rat    89 EGKYNFFCQGTRSAGESDMKVIRVLWWYYF-SKLIEFMDTFFFILRKNNHQITVLHVYHHATMLN 152

  Fly   145 ---FMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFL 206
               |::..||..:.::|        ..||||:||:||:||..|: .|:::...|||:|||:.|.:
  Rat   153 IWWFVMNWVPCGHSYFG--------ATLNSFIHVLMYSYYGLSS-VPSMRPYLWWKKYITQGQLV 208

  Fly   207 QFMILFAQ-SVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVK---AKSKE 261
            ||::...| |...:|   .|.||....|.|:|..:|::.:|.|||.|||.|   ::.||
  Rat   209 QFVLTIIQTSCGVIW---PCSFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 92/254 (36%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 90/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.