DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl3

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_031729.1 Gene:Elovl3 / 12686 MGIID:1195976 Length:271 Species:Mus musculus


Alignment Length:291 Identity:76/291 - (26%)
Similarity:133/291 - (45%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFTLLDLFRGLPAD---PVHLPMFGTPLP--------AIVIVLGYLLLIFKVGPDFMRSRKPYN 54
            |||:     |||..|   |.....|....|        :.:||:.|||||. ||..:||:||.::
Mouse     5 MNFS-----RGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIV-VGQTYMRTRKSFS 63

  Fly    55 MRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKLYDFRCMTMLS---------SDHPDKDVDRLLTY 110
            :::.:::::|...:.:    ::||.     :::.|....|.:         :.:.|..|.|..::
Mouse    64 LQRPLILWSFFLAIFS----ILGTL-----RMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSF 119

  Fly   111 FYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHV 175
            .:.::||::|.||.|.:|||  :.:..:|.|||..::|.....|....|.|.:.:.  :|..||.
Mouse   120 LFLLSKVVELGDTAFIILRK--RPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMT--MNFGVHS 180

  Fly   176 VMYAYY---FASAWYPNVKSTFWWKEYITKLQFLQFMILFAQSVLT-LW-LNPGCR------FPK 229
            |||.||   .|...:||:...     .||.||.||.::.....:|. :| ...||.      |..
Mouse   181 VMYTYYTMKAAKLKHPNLLPM-----VITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWS 240

  Fly   230 VLQYVQLGGSVSMMTMFGNFYYQTYVKAKSK 260
            .:.|      .:...:|.:|:::.|::.|.|
Mouse   241 FMLY------GTYFILFAHFFHRAYLRPKGK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 68/269 (25%)
Elovl3NP_031729.1 ELO 52..267 CDD:366492 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.