DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl3

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:252 Identity:68/252 - (26%)
Similarity:112/252 - (44%) Gaps:53/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVL------MNSGIFLMGTYYL---FIKKLYDFR 90
            |..|||. |...|:.|:.:.:|:.:::::|...:      :.:|.| ||...:   |.:.:.|  
 Frog    46 YAALIFG-GQRMMKERRRFELRRPLVLWSFTLAVFSIIGAVRTGWF-MGNILITNGFKQSVCD-- 106

  Fly    91 CMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYY 155
             ....|.     .|.:...|.:.::||.:|.||:|.||||  :::..||.|||:.::|   .|:|
 Frog   107 -RAFYSG-----PVSKFWAYAFVLSKVPELGDTLFIVLRK--QKLIFLHWYHHITVLL---YTWY 160

  Fly   156 FY----GPGGQYNLMGYLNSFVHVVMYAYY---FASAWYPNVKSTFWWKEYITKLQFLQFMI-LF 212
            .|    ..||.:..|.|.   ||..||:||   .|....|...:.|     ||..|.||.:: :.
 Frog   161 TYKDTVAGGGWFMTMNYT---VHAFMYSYYTLRAAGIRVPRPCAMF-----ITFTQILQMVMGIV 217

  Fly   213 AQSVLTLWLNPG-CR------FPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKEQ 262
            ..:::..|...| |.      |...|.|      .|...:|.:|:|:.|:|...|.:
 Frog   218 VNALVYSWRQDGSCLSTTENIFWSCLMY------FSYFILFCSFFYKAYLKYPIKNK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 68/250 (27%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.