DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl6l

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:236 Identity:63/236 - (26%)
Similarity:112/236 - (47%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMN-SGIFLMGTYYLFIKKLYDFRCMTMLSSD 98
            |::|:|. |..||:.|:..::||.:::::....:.: .|....|.:.|:|.....|: .::....
Zfish    42 YVVLVFG-GQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFMLYILSTSGFK-QSVCDQS 104

  Fly    99 HPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFY----GP 159
            .....:.:.....:.::|..:|.||:|.||||  :::..||.|||:.:::   .::|.|    ..
Zfish   105 FYYGPISKFWACAFVLSKAPELGDTMFIVLRK--QRLIFLHWYHHITVLV---YSWYSYKDQVAG 164

  Fly   160 GGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQFMILFAQSVLTL-WLNP 223
            ||.:..|.|.   ||.:||:||.|.|....|...  ....||..|..|..:..|.|.|.. |:..
Zfish   165 GGWFMTMNYT---VHALMYSYYAARAAGLRVPKP--CAILITSSQIAQMAMDLAVSALVYRWMQD 224

  Fly   224 G-CRFPKVLQYVQLGG--SVSMMTMFGNFYYQTYVKAKSKE 261
            | |  |..|..:....  .:|.:.:|.:|:||:|:|:...|
Zfish   225 GDC--PSYLDNIVWASLMYLSYLLLFSSFFYQSYMKSSKPE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 63/236 (27%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.