DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and Elovl4

DIOPT Version :10

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:250 Identity:83/250 - (33%)
Similarity:136/250 - (54%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFYYLFIV 80
            ||..||||...|...|||||. ||..:|::|:|:.::.||.:||...||.|...|..:|...:..
Mouse    41 PLMQSPWPTISISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNA 104

  Fly    81 G---ICNLHCIESFPEGHERKQLERVLHAA--YLLNKVLDLMDTVFFVLRKSYKQITFLHIYHHV 140
            |   ||     :|....::..:: |:..|.  |.::|.::.:|||||:|||...|::|||:|||.
Mouse   105 GYSYIC-----QSVDYSNDVNEV-RIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHC 163

  Fly   141 FMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQLCQFF 205
            .| |..:.:...:..||.......:||.:|.:||.||.|::..|.::..:|||:|:|:.||.||.
Mouse   164 TM-FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFH 227

  Fly   206 MLLSY---AIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLRPPKAK 257
            :.:.:   ::|.     :|..|:.:.:..:...:.||:||..||...|..|.::|
Mouse   228 VTIGHTALSLYT-----DCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:460083 82/248 (33%)
Elovl4NP_683743.2 ELO 41..278 CDD:460083 82/249 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 1/4 (25%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.