DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and ELOVL7

DIOPT Version :10

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_079206.2 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:270 Identity:96/270 - (35%)
Similarity:135/270 - (50%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IPQADPNPIP--LAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLY 69
            |..|||....  |..||.|.|::|..|:.||..||...|.||||::||..:..||.|.||     
Human    18 IKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVL----- 77

  Fly    70 FGMVFYYLFIV---GI-CNLHC-IESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYK 129
            |.:...|.|::   || .:..| |..:.......::.|... .|..:|.::|:||:||||||...
Human    78 FSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCW-LYYFSKFIELLDTIFFVLRKKNS 141

  Fly   130 QITFLHIYHHVFMSFGSYALTRYYG----TGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANI 190
            |:||||::||..|.:     |.::|    .||......|||:.||.|||.||.||:..|..:..:
Human   142 QVTFLHVFHHTIMPW-----TWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYL 201

  Fly   191 WWKKYITLTQLCQFFMLLSYAIYVR--FFSPNCGVPRGLL-YLNMVQGVVFIYLFGKFYIDNYL- 251
            |||||:|..||.||.::   ||::.  ||..:|.....:. .:.|....:|:.||..|:...|. 
Human   202 WWKKYLTSLQLVQFVIV---AIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTK 263

  Fly   252 --RPPKAKIN 259
              |.||...|
Human   264 GQRLPKTVKN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:460083 91/257 (35%)
ELOVL7NP_079206.2 ELO 29..269 CDD:460083 89/253 (35%)
HxxHH motif. /evidence=ECO:0000305|PubMed:34117479 147..151 1/3 (33%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.