DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and sit

DIOPT Version :10

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster


Alignment Length:243 Identity:51/243 - (20%)
Similarity:82/243 - (33%) Gaps:80/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IKDYLLMEEEFIRNQERLKPQEEKIEEERSKVDDLR-------GSPMSVGTL--------EEIID 115
            :.|::|:....|.::..:.|            |:|.       |..:|:..|        |.|  
  Fly   382 VLDFVLVAVILISSRTTMNP------------DNLATPLAASIGDVVSISLLAAMATLLFEHI-- 432

  Fly   116 DNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTV--------M 172
            |.|..| |.|....||.:|.|          .:||.::......||.....|:::.        :
  Fly   433 DTHLWV-TFVMVAVYVFLLPF----------WMLLVYRNKYTRSVLSTGWVPVLSALFISGMGGL 486

  Fly   173 KLEKAP---------QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG--------V 220
            .|:||.         |.....|||....:|..|.|..|   |..  ..:||.||..        .
  Fly   487 VLDKAVGIFNGFVVFQPIINGIGGNLVSVQASKISTML---HQS--SIIGIIPPHAKIFELPWRA 546

  Fly   221 ILYGPP--GTGKTLLAKAVANQTSATFL--------RVVGSELIQKYL 258
            :.:|.|  .|.:.|:|.::..|....|:        ..:|:..:..||
  Fly   547 LFHGVPYARTARILIAMSIPGQVLFIFVADYIHMSRSTIGAPFVLSYL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:460083 49/240 (20%)
sitNP_651063.1 ELO 28..252 CDD:460083
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.