DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and CG31522

DIOPT Version :9

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:266 Identity:83/266 - (31%)
Similarity:129/266 - (48%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFYYLFI- 79
            |:..||:|...:.:.|:..|..||...|.||||.:|:..|.:||..||:::    ..:||...: 
  Fly    27 PMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFS----AWLFYECLMG 87

  Fly    80 --VGICNLHC---------------IESFPEGH-----------ERKQLERVLHAA--YLLNKVL 114
              .|..:..|               |..:..||           ...:..|::||.  |..:|..
  Fly    88 GWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFT 152

  Fly   115 DLMDTVFFVLRKSYKQITFLHIYHHVFMSFGSYALTRYYGT----GGHVNAVGLLNSLVHTVMYF 175
            :.|||:||||||...|:|.||:.||     |...::.::|.    |||....||||:.||.|||.
  Fly   153 EFMDTIFFVLRKKSSQVTTLHVIHH-----GCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYT 212

  Fly   176 YYFLSSEYPGVRANIWWKKYITLTQLCQFFMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIY 240
            ||..|:..|..:..:|||||:|..|:.||.:::.:|..:.|.  :|..|:..::...:..|:|.:
  Fly   213 YYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFI--DCNYPKAFVWWIGMHAVMFFF 275

  Fly   241 LFGKFY 246
            ||.:||
  Fly   276 LFNEFY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:279492 83/266 (31%)
CG31522NP_001262254.1 ELO 27..293 CDD:279492 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449637
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1110.930

Return to query results.
Submit another query.