DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and CG17821

DIOPT Version :10

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster


Alignment Length:248 Identity:111/248 - (44%)
Similarity:154/248 - (62%) Gaps:3/248 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ADPNPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVF 74
            |||..:|:.|:|.|..:|::.|||.:.|:|..|||:||||:::..:.:||..|||.|...|.|..
  Fly    14 ADPVHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGT 78

  Fly    75 YYLFIVGICNLHCIESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITFLHIYHH 139
            |||||..:.:..|:......|..|.::|:|...|.:|||:||:||:|||||||.||||.||:|||
  Fly    79 YYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHH 143

  Fly   140 VFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQLCQF 204
            |||..|......:||.||..|.:|.|||.||.|||.|||.|:.||.|::..|||:|||..|..||
  Fly   144 VFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQF 208

  Fly   205 FMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLRPPKAK 257
            .:|.:.::...:.:|.|..|:.|.|:.:...|..:.:||.||...|:   |||
  Fly   209 MILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYV---KAK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:460083 106/240 (44%)
CG17821NP_725820.2 ELO 20..262 CDD:460083 108/242 (45%)

Return to query results.
Submit another query.