DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18609 and tea

DIOPT Version :10

Sequence 1:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:92 Identity:23/92 - (25%)
Similarity:35/92 - (38%) Gaps:23/92 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 FPEG---HERKQL----ERVLHAAYLLNKVLDLMDTVFFVL----RKSYKQITFLHI-YHHVFMS 143
            |.||   |..|.|    |.::...:.:...|||.:..::..    ...||....||: :.|| :.
  Fly  1194 FAEGSKDHNLKYLICTSEGLMRTIWRILYQLDLQEFSYYTSIHDGEDLYKSEDNLHLCFRHV-VD 1257

  Fly   144 FGSYALTRYYGTGGHVNAVGLLNSLVH 170
            .|::.          ||...||..|.|
  Fly  1258 HGNWP----------VNLCVLLPRLKH 1274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18609NP_611365.2 ELO 16..257 CDD:460083 23/92 (25%)
teaNP_724855.2 None

Return to query results.
Submit another query.