DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment List and CG31904

DIOPT Version :9

Sequence 1:NP_611364.2 Gene:List / 37157 FlyBaseID:FBgn0034381 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:104/264 - (39%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKP--AEKPAEQWGNGLEFLF-SCISL--SVGLGNIWRFPYIAFQNGGG-TFVIPYLIALLVIGR 69
            |:|  .:|...:|....:|.| ||...  |:....:..|..:   :||. .|:|.||:.:|....
  Fly    75 ERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSL 136

  Fly    70 PVYYLEISLGQFTGRGVVKAFDMAPLLKGVALGQVLATAASITYYSSIMALTLRFWLASFGSELP 134
            |::.::..||||:..|.:.||.:||:.||:....:|....::||||....:.|.:.:.|....:|
  Fly   137 PIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIP 201

  Fly   135 WSRCWESWGTDCHDGNAQNSSGKMSPAQLYFEREILHEVPNIDNGLSLPNWQLVACLAIAWLVIG 199
            |..|..||       |.|..|              |||..::|..::     ::..||:|     
  Fly   202 WMSCNNSW-------NTQECS--------------LHENYDVDFAVA-----VIFTLALA----- 235

  Fly   200 GVLIRGIKSSGKAAYFLGVFPYVVLLILLLRAVTLPG----AIDGIIYFFKP------QWRELLN 254
                .|::||               :|.||..|...|    |:.|......|      .|...:|
  Fly   236 ----MGVQSS---------------VIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVN 281

  Fly   255 PLVW 258
            ...|
  Fly   282 VASW 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ListNP_611364.2 SLC6sbd 19..489 CDD:271359 62/254 (24%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 42/169 (25%)
Cuticle_4 276..344 CDD:292577 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.