DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment List and Y43D4A.1

DIOPT Version :9

Sequence 1:NP_611364.2 Gene:List / 37157 FlyBaseID:FBgn0034381 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:52 Identity:26/52 - (50%)
Similarity:34/52 - (65%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SKKSEKPAEKPAE-QWGNGLEFLFSCISLSVGLGNIWRFPYIAFQNGGGTFV 57
            ||:.|:....|.. .|||.:|||.|.:.::||||||||||..|:.|||..|:
 Worm    39 SKEIEESQADPCRGAWGNQIEFLLSTLGMAVGLGNIWRFPTRAYNNGGSAFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ListNP_611364.2 SLC6sbd 19..489 CDD:271359 22/40 (55%)
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:294310 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.