DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and zgc:153116

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001038888.1 Gene:zgc:153116 / 751712 ZFINID:ZDB-GENE-060825-107 Length:327 Species:Danio rerio


Alignment Length:391 Identity:98/391 - (25%)
Similarity:147/391 - (37%) Gaps:91/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LTEVIAQQEQQTDSNPPKEQFIKEDNATVNDPETSATLPTEQRRETRSTAKSKAHHSLPPSTPPE 189
            :..|.|..|:.|||.|.||:..:.|....||        ..:..:.|.||:              
Zfish    13 IVRVEADLEEPTDSMPLKEKMQELDTRQAND--------LAENPQNRVTAE-------------- 55

  Fly   190 KSNSVANKSKAKRTPCKAEGTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLL-- 252
                       |:|    ..||||:                              .|:..|.:  
Zfish    56 -----------KQT----TNTPQKA------------------------------AQKRVLRVFF 75

  Fly   253 -CKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHH 316
             ||.             |.|.|..:..|.:|...|.:.....|..|.|.|:....|.||..:.| 
Zfish    76 NCKQ-------------CGKSFTTKDHLKNHTKTHTEKTSLTCKLCKKVFSKYNMLHNHMRIYH- 126

  Fly   317 PEEEKTFMCEQCPKRYTKQYLLDQHRVIH-KERNVVCDLCERRFPNQSLLCTHVKMAHGNYGTMC 380
              |||:|.||.|.|.:|::..|..|:..| ::::..|..|.:.|..::.|..|:|........:|
Zfish   127 --EEKSFTCEHCGKGFTQRGPLKLHKRTHTQDKSKTCQNCGQFFTQKAKLKNHIKTHLDGKSLVC 189

  Fly   381 DICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNG-TAATCDLCGKVS 444
            :.|.:....:.||.||.:.|.|| :| ..||.|......:.:..||.:.|.| ....|..|||..
Zfish   190 EECGRTFYHKEAFDRHMVAHTGV-KP-YHCDQCRRSFAMEAAFDKHKKIHAGEKPLVCKQCGKCF 252

  Fly   445 PNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHT 509
            .::..:..|.. .|..::.|:||.|.|:|.......:||..|.|:..|||..|.|::.|.|....
Zfish   253 YDKLKLKGHVN-GHALEKHHKCSKCGKSFLDEEKFNQHMRFHAGKKPYKCVPCKKSYQSKAGLDL 316

  Fly   510 H 510
            |
Zfish   317 H 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)
C2H2 Zn finger 294..316 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..370 CDD:275368 5/17 (29%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 437..458 CDD:275368 5/20 (25%)
C2H2 Zn finger 466..486 CDD:275368 7/19 (37%)
C2H2 Zn finger 494..512 CDD:275368 6/17 (35%)
zgc:153116NP_001038888.1 COG5048 <67..226 CDD:227381 49/176 (28%)
C2H2 Zn finger 77..97 CDD:275368 7/32 (22%)
C2H2 Zn finger 105..125 CDD:275368 7/19 (37%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 245..265 CDD:275368 5/20 (25%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
C2H2 Zn finger 301..319 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.