DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and si:dkey-154p10.3

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_692110.2 Gene:si:dkey-154p10.3 / 563659 ZFINID:ZDB-GENE-070912-380 Length:646 Species:Danio rerio


Alignment Length:627 Identity:125/627 - (19%)
Similarity:198/627 - (31%) Gaps:199/627 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLCLNNVNDTDTIRIFEDVGLSLNVANVL--------------------AKYFWFEPKSDDPIST 48
            ||...||  |.::.....||:..:|:.::                    ||......:..||:|.
Zfish    17 RLAEENV--TSSLYCNSAVGIEAHVSTLVEAFLVEVYRCRICQFTSSHKAKISHHVMERHDPVSP 79

  Fly    49 VICLTCWNQVNDFHQFYVAVESAHRLLTERFSLKSGQDQGKVEHG------EDSEQQEEEQDEDQ 107
            ...|.|..:           |....|..|    ....|:.:|||.      |...|...:.:|||
Zfish    80 CPHLPCLEK-----------EDEESLCVE----MRVNDEEEVEHNSSPYDLESDLQSGSKSNEDQ 129

  Fly   108 ------------------------ELGLPGSEGGSFTNEQFLTEVIAQQEQQTDSNPPKEQFIKE 148
                                    ::||..|..|:....|........:|.:.|.|..:|:..: 
Zfish   130 MDMERISFLLPMYGMFQNISPRSCDIGLGSSSDGNLHVAQTCEVSTLFEEDRHDDNSDEERVFQ- 193

  Fly   149 DNATVNDPETSATLPTEQRRET--RSTAKSKAHHSLP------PSTPPEKSNSVANKSKAKRTPC 205
                :.|..|..|:|.....:|  :....:::.|.:.      .||..:.|::    :.||..| 
Zfish   194 ----LEDASTDLTVPLNSGMDTEVQDEEMAQSAHLMTLGLCRISSTKGQPSSA----TSAKSLP- 249

  Fly   206 KAEGTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCN 270
              ||.....             ||.:.|.|:.|       :|...|.|             |.|.
Zfish   250 --EGEQDAG-------------DASMDAVMQKT-------EEDGGLAC-------------ILCQ 279

  Fly   271 KKFYKRSFLTDHIDRHADPEKFKCTQC---DKRFADKQCLRNHELLKHHPEEEKTFMCEQCPKRY 332
            .....|..|..|:..|:..:.|:|.:|   .:.:||   :.:|..|....:..|...|..||:.:
Zfish   280 TVASSRVMLDVHLKCHSGEQGFRCPRCGWESEEWAD---MEHHWRLHGKRKGTKRHRCSVCPRSF 341

  Fly   333 TKQYLLDQHRVIHKERNVVCDLCERRFPNQSLLCTHVKMAHGNYGTMCDICAQVIRGRAAFQRHQ 397
            .:....|.|...|..:.                  |.:.:.......|..|.:.......::.||
Zfish   342 RRADSRDAHEERHNHQR------------------HHRRSESGEPVQCSFCLEWCHSGKEWEIHQ 388

  Fly   398 LEHAGVTEPKVQCDIC-GSWHKN-KHSLKKH----VRRHNGTAATCDL-----------C----- 440
            ..|.......:.||.. .:|.|. ||...:|    ..:.|..|.:.|:           |     
Zfish   389 HCHVQGGFKCLHCDFKEKTWKKTLKHIHTQHKQAEANQDNQIAHSRDIQQLSSSAKYPECLRRMQ 453

  Fly   441 -----------------GKVSPN-----RSAMLSHQRYVHLT-DRKHE--CSVCNKAFKKAITLR 480
                             ||...|     |...|..:..|.|| .|:.|  |::|:|.|...:|:|
Zfish   454 PELWSQIRKKKVKNRAVGKEKSNEGGKDRVKHLKAETSVGLTVTRRKEFCCNLCDKKFSTKLTMR 518

  Fly   481 EHMTMHTGEVLYKCPHCPKTFNSNANQHTHRR--------KC 514
            .||.:|.|:..:|||||.......|:...|.|        ||
Zfish   519 RHMGIHQGDKPFKCPHCHYCTRLKASLIQHLRIHTGEKPYKC 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 17/93 (18%)
C2H2 Zn finger 269..286 CDD:275368 4/16 (25%)
C2H2 Zn finger 294..316 CDD:275368 6/24 (25%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..370 CDD:275368 1/17 (6%)
C2H2 Zn finger 410..430 CDD:275368 7/25 (28%)
C2H2 Zn finger 437..458 CDD:275368 7/58 (12%)
C2H2 Zn finger 466..486 CDD:275368 8/19 (42%)
C2H2 Zn finger 494..512 CDD:275368 6/17 (35%)
si:dkey-154p10.3XP_692110.2 C2H2 Zn finger 275..295 CDD:275368 6/32 (19%)
C2H2 Zn finger 303..323 CDD:275368 5/22 (23%)
C2H2 Zn finger 334..350 CDD:275368 4/15 (27%)
COG5048 <500..632 CDD:227381 21/61 (34%)
C2H2 Zn finger 504..524 CDD:275368 8/19 (42%)
zf-H2C2_2 517..539 CDD:290200 10/21 (48%)
C2H2 Zn finger 532..552 CDD:275368 7/19 (37%)
C2H2 Zn finger 560..580 CDD:275368 1/1 (100%)
zf-H2C2_2 572..594 CDD:290200
C2H2 Zn finger 588..608 CDD:275368
C2H2 Zn finger 616..636 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.