DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and zfp91

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_021326898.1 Gene:zfp91 / 555616 ZFINID:ZDB-GENE-090313-11 Length:792 Species:Danio rerio


Alignment Length:401 Identity:77/401 - (19%)
Similarity:137/401 - (34%) Gaps:142/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LKSGQDQGKVEHGEDSEQQEEEQDEDQELGLPGSEGGSFTNEQFLTEVIAQQEQQTDSNPPKEQF 145
            :.|.:.|.|.....||....:|.:...::...|.|  :.::::   :|..:.:....|..||: |
Zfish   227 IPSVRRQDKHSTMTDSSSDSDEAESSSQIPHEGEE--TISSDE---DVPFRDDLNDQSYDPKD-F 285

  Fly   146 I------------KEDNATVNDPETSATLPTEQRRETRS----TAKSKAHHSLPP-STPPEKSNS 193
            .            |:|..||.:      .||||..|.::    |.:.:....:.. :.||.|...
Zfish   286 SKSKRRPHTRLKEKKDKPTVQE------TPTEQETEIKTEGGETTEEQTRAEVEEGAEPPRKRGR 344

  Fly   194 VANKSKAKRTPCKAEGTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLLCKHMLQ 258
            .....|:.|.|.:.:..|      ..|.:|.::....:.||.|..                    
Zfish   345 RRKDDKSPRLPKRRKKPP------VQYVRCEMEGCGTVLAHPRYL-------------------- 383

  Fly   259 EHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQ--CDKRF-ADKQCLRNHELLKHHPEEE 320
            :||.|          |          :|...:|:.|..  |.:.| ..||.||:   .||| .::
Zfish   384 QHHIK----------Y----------QHLMKKKYVCPHPTCGRLFRLQKQLLRH---AKHH-TDQ 424

  Fly   321 KTFMCEQCPKRYTKQYLLDQHRVIHKERNVVCDLCERRFPNQSLLCTHVKMAHGNYGTMCDICAQ 385
            :.::||.|.:.:...:.|..||:||                                        
Zfish   425 RDYICEFCARAFKSSHNLAVHRMIH---------------------------------------- 449

  Fly   386 VIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGTAA---TCDLCGKVSPNR 447
                             ..|..:||:|||...:.|.||..|:::|:..|.   :|.:|||....:
Zfish   450 -----------------TGEKPLQCEICGFTCRQKASLNWHMKKHDADATYQFSCSICGKKFEKK 497

  Fly   448 SAMLSHQRYVH 458
            .::::|:...|
Zfish   498 DSVVAHKAKSH 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 1/16 (6%)
C2H2 Zn finger 294..316 CDD:275368 8/24 (33%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..370 CDD:275368 0/17 (0%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 437..458 CDD:275368 5/20 (25%)
C2H2 Zn finger 466..486 CDD:275368
C2H2 Zn finger 494..512 CDD:275368
zfp91XP_021326898.1 zf-C2H2_8 368..445 CDD:318181 24/120 (20%)
C2H2 Zn finger 402..421 CDD:275368 7/21 (33%)
C2H2 Zn finger 429..449 CDD:275368 6/19 (32%)
zf-C2H2 456..477 CDD:306579 9/20 (45%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
C2H2 Zn finger 487..503 CDD:275368 4/15 (27%)
Amelogenin <633..>716 CDD:330537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.