DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG6254

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:571 Identity:137/571 - (23%)
Similarity:229/571 - (40%) Gaps:76/571 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLNN--VNDTDTIRIFEDVGLSLNVANVLAKYFWFEPKSDDPISTVICLTCWNQVNDFHQFY 65
            ||||...  .|.....|..:....:..:|..:.||||.:.|.:|.:|..:|..|:..::...:|.
  Fly    22 CRLCSKEHPTNQNVFFREAKQNSWASTMAMTIGKYFWVDIKREDELSNFLCSECFTLMDCLIEFS 86

  Fly    66 VAVESAHRLLTERFSLKSG---------QDQGKVEHG---------EDSEQQEEEQ--DEDQELG 110
            ..|.....|.::...|:|.         :|.|....|         ::|..|.:|.  .|:|.:.
  Fly    87 ERVRKVQILFSKLQLLQSNNLMDYEKIREDCGVATDGWKHIMLGAVDESLPQNDEVFISEEQPIV 151

  Fly   111 LPGSEGGSFTNE-----QFLTEVIAQQEQQTDSNPPKEQFIKEDNATVNDPE---TSATLPTEQR 167
            ..........:|     .||.|....||:|   :.|||:.:.|:...::..|   ....:..:..
  Fly   152 CQTETSSKMKSEILMIPNFLVEKQCLQEKQ---DFPKEEDVIEEEMQISGVEEEILEEDVEEDLA 213

  Fly   168 RETRSTAKSKAHHSLPPSTPPEKSNSVANKSKAK-RTPCKAEGTPQKSK-RYADYKQCMLDIDAK 230
            .|...|.:.:.      .|..|:..:|..:.:.: .|.|..|.....:: ||.:..|.:  .:::
  Fly   214 EEEVETVEEEI------DTVGEEVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQII--EESQ 270

  Fly   231 ISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCN---KKFYKRSFLTDHIDRHAD-PEK 291
            :|.....|.::.....:...:..|..::       :|..|   ::...|..:||..|..:: |..
  Fly   271 VSDFNMETYEIVQHNPQKEPVETKDTVE-------SIESNEDTQEDISREHVTDEEDEISEVPAM 328

  Fly   292 FKCTQCDKRFADKQCLRNHELLKHH------PEEEKTFMCEQCPKRYTKQYLLDQHRVIH----- 345
            :||..|.|.:...:..:.|....|:      |:.|    |.||...:.....|..|...|     
  Fly   329 YKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQLE----CNQCKLCFPTVAQLHAHHRTHVRAKP 389

  Fly   346 KERNVVCDLCERRFPNQSLLCTHVKMAHGNYGT-MCDICAQVIRGRAAFQRHQLEHAGVTEPKVQ 409
            |..| .|..||:||.....|..|::..|..... :||:|.:........:.|:|.|  ..|...:
  Fly   390 KTDN-CCPHCEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVH--TDECPFE 451

  Fly   410 CDICGSWHKNKHSLKKHVRRHNGTAATCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFK 474
            |.:|....||...||.|:..|:.....|.:||.....|.....| :.||...|:.:|.||..|||
  Fly   452 CPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKH-KLVHSDTRQFKCEVCGSAFK 515

  Fly   475 KAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHTHRRKCHPKEF--EEAR 523
            ::.||:.|:.:|||...|||..|.:.|.:.:|..:|:|:.||||.  ||||
  Fly   516 RSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELAEEEAR 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 19/76 (25%)
C2H2 Zn finger 269..286 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..316 CDD:275368 4/21 (19%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..370 CDD:275368 7/17 (41%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 437..458 CDD:275368 5/20 (25%)
C2H2 Zn finger 466..486 CDD:275368 9/19 (47%)
C2H2 Zn finger 494..512 CDD:275368 5/17 (29%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071 19/76 (25%)
COG5048 <353..554 CDD:227381 60/208 (29%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 5/19 (26%)
C2H2 Zn finger 452..472 CDD:275368 7/19 (37%)
C2H2 Zn finger 479..499 CDD:275368 5/20 (25%)
C2H2 Zn finger 507..527 CDD:275368 9/19 (47%)
zf-H2C2_2 520..544 CDD:290200 10/23 (43%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.