DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and znf131

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_956799.2 Gene:znf131 / 393477 ZFINID:ZDB-GENE-040426-1563 Length:558 Species:Danio rerio


Alignment Length:452 Identity:95/452 - (21%)
Similarity:157/452 - (34%) Gaps:136/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 STPPEKSNSVANKSKAKRTP-CKAEGTPQKSKRYADYKQCMLDID-------------------- 228
            :|.|:...|.|.|.|...|. ...|..|.     ||.:...::::                    
Zfish   128 TTSPQPGKSKAKKRKISETSNVITESLPS-----ADTEAVEIEVEVGEEHIEVEESGLVEVVDVA 187

  Fly   229 ------AKISAHMRLTCDVC---HEGQETFLLLCK----HMLQEHHRKGYAICCNKKFYKRSFLT 280
                  :...:.:.|..|:.   .:|::|..::.|    .::||.     |:..:|.......:.
Zfish   188 RGTTVPSSDDSALALLADITSKYQQGEQTLHVIKKVDETVVVQEE-----AVVASKTLENIEVVE 247

  Fly   281 DHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHHPEEEKTFMCEQCPKRYTKQYLLDQH-RVI 344
            ..|.:.  ...|:|.:||:.|.....|:.| :..|....|:.|:|..|.|.|.::..|.|| ...
Zfish   248 VQISQL--DNLFRCDKCDRCFKLYYHLKQH-MKTHIASPERGFVCRHCGKAYAREGALKQHLNNY 309

  Fly   345 H----------KERNVVCDLCERRFPNQSLLCTHVKMAHGNYGTMCDICAQVIRGRAAFQRHQLE 399
            |          |::..||:.||::|.:         ..|                   |:.|..:
Zfish   310 HFDAEEQSRRQKKKVHVCEYCEKQFDH---------FGH-------------------FKEHLRK 346

  Fly   400 HAGVTEPKVQCDICGSWHKNKHSLKKHVRR-HNGTAATCDLCGKVSPNRSAMLSHQRYVHLTDRK 463
            |.|  |...:|..|........:||.|:.. .||:.|.                       ..||
Zfish   347 HTG--EKPFECPECHERFARNSTLKCHMSACQNGSGAK-----------------------KGRK 386

  Fly   464 --HECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHTHRRKCHPKEFEEARKAR 526
              :||.||:..|......::|:..||||....|..|...|.|..:.|||.::.|..:        
Zfish   387 KLYECQVCSSVFNSWEQFKDHLVTHTGEKPNHCTLCDLWFTSPRDLHTHLQEHHSLQ-------- 443

  Fly   527 TEKRKAIEE----ETPSVLTISTGEDGESHSILLTN------TEEDIKGDTIEFTLCLSADT 578
             ||....|:    :..:||::   |:||...||...      |.|.:....:|.||.:..:|
Zfish   444 -EKVIVAEDILISDPANVLSM---EEGEERVILEDGIRVEHVTVEPVDVVAVEETLVVEEET 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 2/16 (13%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 7/20 (35%)
C2H2 Zn finger 352..370 CDD:275368 4/17 (24%)
C2H2 Zn finger 410..430 CDD:275368 5/20 (25%)
C2H2 Zn finger 437..458 CDD:275368 0/20 (0%)
C2H2 Zn finger 466..486 CDD:275368 5/19 (26%)
C2H2 Zn finger 494..512 CDD:275368 7/17 (41%)
znf131NP_956799.2 BTB 24..120 CDD:306997
zf-C2H2 257..279 CDD:306579 7/22 (32%)
C2H2 Zn finger 259..279 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..347 CDD:275368 17/85 (20%)
COG5048 <310..441 CDD:227381 40/183 (22%)
C2H2 Zn finger 327..344 CDD:275368 6/44 (14%)
zf-H2C2_2 339..364 CDD:316026 8/45 (18%)
C2H2 Zn finger 355..372 CDD:275368 4/16 (25%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.