DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG4282

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster


Alignment Length:681 Identity:179/681 - (26%)
Similarity:276/681 - (40%) Gaps:187/681 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRLCLNNVNDT--DTIRIFEDVGLSLNVANVLAKYF--WFEPKSDDPISTVICLTCWNQVNDFHQ 63
            |.||:......  |.|.:....|..|.|..::.::|  ....:||:.    ||..||..|:|||.
  Fly     7 CLLCMCEYPAMMGDYIDVHSARGDQLEVTTIVNQHFPVQISKESDER----ICGRCWKIVSDFHT 67

  Fly    64 FYVAVESAHRLLTERFSLKSGQDQGKVEHGED----------------SEQQEEEQDEDQELGLP 112
            .:..|.:|...|.|.          ||...||                :.|:||...|.||||  
  Fly    68 LHEFVSAAQSSLQET----------KVALMEDDPLTQETTSFPEIIKLATQEEEGVTEPQELG-- 120

  Fly   113 GSEGGSFTNEQFLTEV--------------IAQQEQQTDSNPP---------KEQFIKEDNATVN 154
               |.:|    |..|:              |.::...|..|..         :::...||.::|:
  Fly   121 ---GRNF----FYPEIKIEEHELDTLPRIEILERSANTQENQDQLEGAARRLRKRLKAEDGSSVD 178

  Fly   155 D-------PETSATLPTEQRR-ETRSTAKSKAHHSLPPSTPPE---------------------- 189
            .       .||:...|.::|| ..|.:..:.|    ||..|.|                      
  Fly   179 KDKDEDGVEETAEPAPPKKRRGRPRKSDAAVA----PPQKPKEDIQLDLKAEELDEFVDEETDPD 239

  Fly   190 ---------------------------------------KSNSVANKSKAKRT-PCK------AE 208
                                                   |...|..|...||| |.:      .|
  Fly   240 FSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKKRTKPAEPKVRMSRE 304

  Fly   209 GTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLLCKHM--LQEHHR------KGY 265
            ...|:.|:..:|..    |.||....: |.|.:|:       ||..:.  :|.|||      .||
  Fly   305 LLEQRKKQQEEYDV----IIAKFFTSV-LPCAICN-------LLVHNFTEMQRHHRLTHQVDPGY 357

  Fly   266 AICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHHPEEEKTFMCEQCPK 330
            .:||.:||.:|..|.:|:..|.:|:.|||:.|:|.|.:.:.|.:|:.:...|..:.||.|:.|.|
  Fly   358 MMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSK 422

  Fly   331 RYTKQYLLDQHR----VIHKERNVVCDLCERRFPNQSLLCTHVKMAHGNYGT-MCDICAQVIRGR 390
            .:..:..:|.|:    |...|....|..|.::|..:..|..|:...|....| :||.|.:.:|.:
  Fly   423 TFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTK 487

  Fly   391 AAFQRHQ-LEHAGVTEPK---VQCDICGSWHKNKHSLKKHVRRHNGTAA---TCDLCGKVSPNRS 448
            ...::|| |.|:....|:   .||.|||:|.|....||:|::..:..:|   .|.:|.|||||..
  Fly   488 IILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSPNAR 552

  Fly   449 AMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHTHRRK 513
            |:..|..:.|..:||.:|::|.||||:...|:||.:.|||||||.||:||.||..:||.:.||::
  Fly   553 ALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQR 617

  Fly   514 CHPKEFEEARKARTEKRKAIEEETPSVLTIS 544
            .|..::|..:.         :.:.|::|.||
  Fly   618 LHRAQYEADKN---------QPKPPNILKIS 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 22/78 (28%)
C2H2 Zn finger 269..286 CDD:275368 6/16 (38%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/23 (26%)
C2H2 Zn finger 352..370 CDD:275368 5/17 (29%)
C2H2 Zn finger 410..430 CDD:275368 9/19 (47%)
C2H2 Zn finger 437..458 CDD:275368 9/20 (45%)
C2H2 Zn finger 466..486 CDD:275368 9/19 (47%)
C2H2 Zn finger 494..512 CDD:275368 9/17 (53%)
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 22/77 (29%)
FYDLN_acid <191..268 CDD:302856 9/80 (11%)
C2H2 Zn finger 330..351 CDD:275368 8/27 (30%)
C2H2 Zn finger 360..378 CDD:275368 7/17 (41%)
LIM 361..>400 CDD:295319 14/38 (37%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2_8 389..465 CDD:292531 19/75 (25%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 4/16 (25%)
C2H2 Zn finger 477..498 CDD:275368 7/20 (35%)
C2H2 Zn finger 511..532 CDD:275368 9/20 (45%)
C2H2 Zn finger 541..562 CDD:275368 9/20 (45%)
C2H2 Zn finger 570..590 CDD:275368 9/19 (47%)
C2H2 Zn finger 598..619 CDD:275368 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.