DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG8388

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster


Alignment Length:590 Identity:189/590 - (32%)
Similarity:286/590 - (48%) Gaps:77/590 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLNNVND-TDTIRIFEDVGLSLNVANVLAKYFWFE-PKSDDPISTVICLTCWNQVNDFHQ 63
            |.|.||...|:| ...|....:...||.:..::.|:||.: |  |...:..:|..||.|:..||.
  Fly     1 MPCFLCTQTVDDAAGNIEFASEEADSLGLRCIIEKHFWLQIP--DSKRAGYVCGPCWEQLLLFHN 63

  Fly    64 FYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEEEQDEDQELGLPGSEGGSFTNEQFLTEV 128
            ||:.||.||:.| |:..||.......|....:....:.|.|:        |...:....:.....
  Fly    64 FYLNVEQAHKAL-EQTVLKETSPPEVVASALEEHIVKSEHDD--------SVAAAVKRRRGRPRK 119

  Fly   129 IAQQE---------QQTDSNPPKEQFIKEDNA---TVNDPETSATLP----TEQRRETRSTAKSK 177
            :|||:         :|.:.|..|.:|.:.|..   .:.|.|....||    :::..|.....:.|
  Fly   120 VAQQDAREELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDFLPDDCISKEGAEDPEVLEKK 184

  Fly   178 AHHSLPPSTPPEKSNSVANKSKAKR---------TPCKAEGTPQKSKRYADYKQCMLDIDAKISA 233
                     ||.....|:.:|:.:|         |.|..:  .|||:.:.||          |..
  Fly   185 ---------PPTLKRKVSGRSRGRRRVQLAERPNTSCLPK--IQKSQEFNDY----------IRE 228

  Fly   234 HMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCD 298
            |.::.|.:|:...|.|..:..|:.:||.::|||:|||:||.||..|.||:.||.|||.|||:.|.
  Fly   229 HYKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICG 293

  Fly   299 KRFADKQCLRNHELLKHHPEEEKTFMCEQCPKRYTKQYLLDQHRVIHKER---NVVCDLCERRFP 360
            :....::.|..|..:.......:.:.||||.|.:....:.::|::.|..|   .|.|..||:.:|
  Fly   294 RVMGHRRSLELHMRMHEIKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHCEKTYP 358

  Fly   361 NQSLLCTHVKMAHGN-YGTMCDICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLK 424
            :|..:..|||:.|.| |..:||:|.:.||||.|..||..||.|..:..::|.:|.|....|:.|.
  Fly   359 SQYTMQQHVKLVHLNLYAKICDVCGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKYGLA 423

  Fly   425 KHVR----RHNGTAATCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTM 485
            :|::    ..|.....|:.|.|:.|:..|...|.:|.|.|.|.|:|.:|.||||:...|:||||.
  Fly   424 RHIKMMHTAENLQPMQCEFCLKICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKRPNELKEHMTT 488

  Fly   486 HTGEVLYKCPHCPKTFNSNANQHTHRRKCHPKEFEEARKARTEKRKAIEEETPSVLTIS------ 544
            |||||||.|||||:|||||||.|.||:|.|.||:||.|..|..:.:    ::.:::.:|      
  Fly   489 HTGEVLYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSR----KSDTIIAVSVRKTTE 549

  Fly   545 TGEDG 549
            |.:||
  Fly   550 TRQDG 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 26/77 (34%)
C2H2 Zn finger 269..286 CDD:275368 9/16 (56%)
C2H2 Zn finger 294..316 CDD:275368 4/21 (19%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 6/23 (26%)
C2H2 Zn finger 437..458 CDD:275368 7/20 (35%)
C2H2 Zn finger 466..486 CDD:275368 11/19 (58%)
C2H2 Zn finger 494..512 CDD:275368 14/17 (82%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 20/58 (34%)
C2H2 Zn finger 264..281 CDD:275368 9/16 (56%)
C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..369 CDD:275368 7/18 (39%)
C2H2 Zn finger 440..461 CDD:275368 7/20 (35%)
C2H2 Zn finger 469..489 CDD:275368 11/19 (58%)
C2H2 Zn finger 497..515 CDD:275368 14/17 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D28261at33392
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 1 1.000 - - mtm14827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11788
77.020

Return to query results.
Submit another query.