DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG30020

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:533 Identity:111/533 - (20%)
Similarity:185/533 - (34%) Gaps:146/533 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DPISTVICLTCWNQVNDFHQFYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEEEQDEDQE 108
            :|:::|   |...|.|:..|..|..|.    :||......|.::|..:.|  :..:.|....::|
  Fly   912 EPVNSV---TVDGQHNEMMQTDVGAEK----MTEALGNGDGNEEGGTDDG--TGVKAEPAVPEEE 967

  Fly   109 LGLPGSEGGSFTNEQFLTEVIAQQEQQTDSNPPKEQFIKEDNATVNDPETSATLPTEQRRETRST 173
            |.....:..:......:...|:.....|                    .||...|.       :|
  Fly   968 LDPVTLDAATAVTTTAIAAAISAAAAAT--------------------ATSLESPV-------AT 1005

  Fly   174 AKSKAHHSLPPSTPPEKSNSVANKSKAKRTPCKAEGTPQKSKRYADYKQCMLDIDAKISAHMRLT 238
            ..|.:....|..||.:....:......:.:|                  .:.|:...:|.:...:
  Fly  1006 TASSSTTLFPTPTPFDFDYDIMRDEAQQSSP------------------NIHDVSKALSDNASSS 1052

  Fly   239 CDVCHEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFAD 303
            |.:    .|::.||....|:....||  :..|.:.::.|.   ||          |..|::.|.:
  Fly  1053 CPI----NESYKLLSTTALETSPAKG--LRSNSRLHRSSI---HI----------CKLCNQTFDE 1098

  Fly   304 KQCLRNHELLKHHPEEEKTFMCEQCPKRYTKQYLLDQHRVIHKERNVVCDLCERRFPNQSLLCTH 368
            ...|..||:..|...|.         .|:..|         ||     |.:|...:...:||..|
  Fly  1099 LGKLVKHEMELHSNTER---------SRWGYQ---------HK-----CAICNTSYRTLTLLKFH 1140

  Fly   369 VKMAHGNYGTMCDICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGT 433
            :| .|.|..:.|.:|.:.....|..:||.                    |.|||..|.:|     
  Fly  1141 MK-RHSNRKSQCKLCPKSFVTIAELERHT--------------------KAKHSKDKTLR----- 1179

  Fly   434 AATC--DLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPH 496
               |  |.|.|....:..::.||:..||:.| :.|.||||..|..:.|:.||::|.||:.||||.
  Fly  1180 ---CFMDGCRKTFAFKHHLIRHQKASHLSTR-YICPVCNKEEKSNVHLKNHMSVHKGEITYKCPK 1240

  Fly   497 CPKTFNSNANQHTHRRKCHPKEFEEARKARTEK-----RKAIEEETPSVLTISTGEDGESHSILL 556
            |.:::.......||....|...|      .||:     ..|..:..|:.|.::|       .:.|
  Fly  1241 CDRSYLRRGRLVTHALIIHDLRF------TTEELGNLSSLATNQARPNDLKVAT-------PVGL 1292

  Fly   557 TNTEEDIKGDTIE 569
            .:..:|:.|.:.|
  Fly  1293 LDGRKDVSGASEE 1305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 9/33 (27%)
C2H2 Zn finger 269..286 CDD:275368 4/16 (25%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 2/19 (11%)
C2H2 Zn finger 352..370 CDD:275368 5/17 (29%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 437..458 CDD:275368 6/22 (27%)
C2H2 Zn finger 466..486 CDD:275368 9/19 (47%)
C2H2 Zn finger 494..512 CDD:275368 5/17 (29%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 6/20 (30%)
C2H2 Zn finger 1124..1144 CDD:275368 6/20 (30%)
C2H2 Zn finger 1151..1172 CDD:275368 6/40 (15%)
C2H2 Zn finger 1180..1203 CDD:275368 6/22 (27%)
C2H2 Zn finger 1210..1230 CDD:275368 9/19 (47%)
C2H2 Zn finger 1238..1254 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.