DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG10462

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_609996.2 Gene:CG10462 / 35260 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster


Alignment Length:262 Identity:55/262 - (20%)
Similarity:79/262 - (30%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 CTQCDKRFADKQC-LRNHELLKHHPEEEKTFMCEQCPKRYTKQYLLDQHRV------IHKERNVV 351
            |..|.:.| :|.| .|.|...||...:||   |...........:|.|...      :|...|..
  Fly   514 CPLCQRMF-EKHCAFRAHLTNKHDLTDEK---CNVLKVVLMPSKILSQDSANAATQRVHVPLNPQ 574

  Fly   352 CDLCERRFPN-----------------QSLLCTHVKMAHG-------------------NYGTMC 380
            ..:.....||                 |:...::|.:..|                   |....|
  Fly   575 TPVPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKGLSPTSINIEKPKVSKKPKKNQSFQC 639

  Fly   381 DICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGTAATCDLCGKVSP 445
            ..|.:|.....|.:.|:..|.|  |...||..|....:....::.|.|||.|             
  Fly   640 TECLKVFTTFGALRIHKSIHTG--ELPYQCSYCDKRFRTPGQVRVHHRRHTG------------- 689

  Fly   446 NRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHTH 510
                           ::..:|.:|:..|....||..|::.|.|...|||..|.|.|...:....|
  Fly   690 ---------------EKPFKCKICSLDFTHRETLISHLSRHIGMKRYKCYGCDKYFVVVSGLRAH 739

  Fly   511 RR 512
            ||
  Fly   740 RR 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368
C2H2 Zn finger 294..316 CDD:275368 8/22 (36%)
C2H2 Zn finger 325..345 CDD:275368 3/25 (12%)
C2H2 Zn finger 352..370 CDD:275368 3/34 (9%)
C2H2 Zn finger 410..430 CDD:275368 4/19 (21%)
C2H2 Zn finger 437..458 CDD:275368 0/20 (0%)
C2H2 Zn finger 466..486 CDD:275368 6/19 (32%)
C2H2 Zn finger 494..512 CDD:275368 5/17 (29%)
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 5/19 (26%)
zf-H2C2_2 651..676 CDD:290200 8/26 (31%)
C2H2 Zn finger 667..687 CDD:275368 4/19 (21%)
zf-H2C2_2 680..704 CDD:290200 8/51 (16%)
C2H2 Zn finger 695..715 CDD:275368 6/19 (32%)
C2H2 Zn finger 723..742 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.