DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and kmg

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:554 Identity:114/554 - (20%)
Similarity:181/554 - (32%) Gaps:160/554 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VEHGEDSEQQEEEQDEDQELGLPGSEGGSFTNEQFLTEVIAQQEQQTDSNPPKEQFIKEDNATVN 154
            :::|...||.:.|. :.||:.|..|.......::.|     |.:|..:|:........|....:.
  Fly   223 IQNGPPLEQLKVEL-QQQEMQLLASVQAYNRQQEML-----QLQQIVESHDNIFSMAYEFQTKLM 281

  Fly   155 DPETSATLPTEQRR---ETRSTAKSKAHHSLPPSTPPEKSNSVANKSKAKRTPCKAEGTPQKS-- 214
            .|:.:.:|..||:.   ::..||||       ||  |:....|:.|.:.:...| :..||.::  
  Fly   282 PPKQAESLKLEQQNSSSDSEETAKS-------PS--PDTRELVSGKEQFQCQKC-SYSTPIRARF 336

  Fly   215 KRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFL 279
            |::..|....|           :.|..|                :.|..          ||.: |
  Fly   337 KKHVKYHSMPL-----------IKCSSC----------------DFHTP----------YKWN-L 363

  Fly   280 TDHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHHP-----------EEEKTFMCEQC----- 328
            ..|...|.....|||:.||.....||.|..||...|.|           :|.:..:.:|.     
  Fly   364 DRHTKNHGANGHFKCSCCDFSTDIKQSLTIHESNHHVPMPVHQMGNRSRDEAEDLVDQQSSGSRK 428

  Fly   329 PKRYTK--QYLLDQHRVIHKERNVVCDLCERRFPNQSLLCTHVKMA----HGNYGTMCDICAQVI 387
            |:.:..  ..:.....::.:...:||..|::|..|...|..|:::.    |........|.|:|.
  Fly   429 PETFKNGGATVASTESLLPRTSGIVCSHCQKRVGNAMQLINHLQVCTLALHNTTQLQASINAEVD 493

  Fly   388 RGRAAFQR--HQLEHAGV--------------TEPK--------VQCDICGSWHKNKHSLKKHVR 428
            .....|..  ..|.:.||              .||:        .:|..|..|.........|:.
  Fly   494 LHDEDFPNAPTDLSYCGVETAPGYGEVTEVLPEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIV 558

  Fly   429 RH-NGTAATCDLCGKVSPNRSAMLSHQRYVHLTDRKH---------ECSVCNKA-FKKAIT---- 478
            .| |.....|.||...|..|..:..|.|...|.||.|         |....|.| :.:.:|    
  Fly   559 GHLNRKPFECSLCAYRSNWRWDITKHIRLKALRDRSHNQAQVLMNDETGRRNYAKYNQYLTMMKV 623

  Fly   479 ----LREHMTMHTGEVLYKCPHCPKTFNSNANQHTHRRKCHPKEFEEARKARTEKRKAIE----E 535
                |.:...|.|||::...|       ...:.|      ||.|.||          .||    .
  Fly   624 SAEQLADSKGMRTGEMIVMPP-------EKLDDH------HPMETEE----------IIEMVDSA 665

  Fly   536 ETPSVLTISTGEDGESHSILLTNTEEDIKGDTIE 569
            .:.|.|.:....|.::         ||:.|::.|
  Fly   666 HSTSALDLRKPRDDQT---------EDLAGNSDE 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 4/16 (25%)
C2H2 Zn finger 294..316 CDD:275368 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 2/26 (8%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 4/19 (21%)
C2H2 Zn finger 437..458 CDD:275368 7/20 (35%)
C2H2 Zn finger 466..486 CDD:275368 4/28 (14%)
C2H2 Zn finger 494..512 CDD:275368 2/17 (12%)
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 4/19 (21%)
C2H2 Zn finger 568..586 CDD:275370 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.