DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG11695

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:566 Identity:160/566 - (28%)
Similarity:261/566 - (46%) Gaps:85/566 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLNNVNDTDTIRIFE-----DVGLSLNVANVLAKYFWFEPKSDDPISTVICLTCWNQVND 60
            |||||||::..  .::.||:     |..:..|:|.::.|:.......:|.:|..:|..||.|:.|
  Fly     1 MICRLCLDDAE--HSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLAD 63

  Fly    61 FHQFYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEEEQDEDQELGLPGSEGGSFTNEQFL 125
            |.||...|          ...:.|..|.|:|        ...:|||.:           |..|.|
  Fly    64 FEQFCAMV----------MKKQLGLQQLKME--------PFSEDEDAD-----------TKAQIL 99

  Fly   126 TEVIAQQEQQTDSNPPKEQFIKEDNATVNDPE-------TSATLPTEQRRETRSTAKSKAHHSLP 183
            .      |.:.|.:|     ...||...|:.:       .|:::.|...||.|..:..:....||
  Fly   100 C------EPEIDVSP-----AAADNEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLP 153

  Fly   184 PSTPPEKSNSVANKSKAKRTPCKA--------EGTPQKSKRYADYKQCMLDIDAKISAHMRLTCD 240
            .:....|:.:|..|::.|....:|        ||.|:  .|.::.:    ::|:.|:.|.||.|.
  Fly   154 RAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPE--SRSSNSR----EMDSYIALHGRLECC 212

  Fly   241 VCHEGQE--TFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFAD 303
            :|...::  .|..:.:|....|...||.:||.:::.||:...||:..|.||..|:|..|.|:...
  Fly   213 ICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVS 277

  Fly   304 KQCLRNHELLKHHP-EEEKTFMCEQCPKRYTKQYLLDQHRVIH-KERNVVCDLCERRFPNQSLLC 366
            :.....| :|:.|| :::.:|.|:||.||::||:||..|..:| :|||..|..|:|.|.....|.
  Fly   278 RISYDVH-MLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLR 341

  Fly   367 THVKMAH--GNYGTMCDICAQVIRGRAAFQRHQ--LEHAGVTEPKVQCDICGSWHKNKHSLKKHV 427
            .|::..|  .....:||.|....:.:.....|:  :...|...|:|||..|..|..:::||:||:
  Fly   342 LHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHM 406

  Fly   428 RRHNGTAA----TCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTG 488
            ..|...|:    .|:.||....:|:.:.:|.|| |.....|:|:.|.|.||.:.:|.||...|||
  Fly   407 YMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRY-HHPKEYHKCTHCAKEFKSSRSLEEHTATHTG 470

  Fly   489 EVLYKCPHCPKTFNSNANQHTHRRKCHPKE---FEEARKARTEKRK 531
            :.||:|..|.:||.::.|.|.|||:.|..:   .::.:|....|||
  Fly   471 QDLYECAFCERTFKNSGNMHKHRRQMHAAQVAALQQQKKVPPSKRK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 23/80 (29%)
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)
C2H2 Zn finger 294..316 CDD:275368 5/21 (24%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 437..458 CDD:275368 7/20 (35%)
C2H2 Zn finger 466..486 CDD:275368 8/19 (42%)
C2H2 Zn finger 494..512 CDD:275368 7/17 (41%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 24/90 (27%)
C2H2 Zn finger 268..289 CDD:275368 5/21 (24%)
C2H2 Zn finger 299..319 CDD:275368 10/19 (53%)
C2H2 Zn finger 327..348 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..376 CDD:275368 4/18 (22%)
C2H2 Zn finger 389..409 CDD:275368 7/19 (37%)
C2H2 Zn finger 420..440 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..468 CDD:275368 8/19 (42%)
C2H2 Zn finger 476..494 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C0KF
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25790
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.