DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG11696

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:611 Identity:175/611 - (28%)
Similarity:257/611 - (42%) Gaps:113/611 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLNNVNDTDTIRIF---EDVGLSLN--VANVLAKYFWFEPKSDDPISTVICLTCWNQVND 60
            |||||||.:..  ..:.||   ..:|...:  :|.::.::.......:|.:||.:|..||.|:.:
  Fly     1 MICRLCLEDAE--HGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAE 63

  Fly    61 FHQFYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEEEQ-----DEDQELGLPGSEGGSFT 120
            ..||...|....|.|.....||:       |..|..|..|.|.     :.:..:....|..|...
  Fly    64 IEQFCSMVAEKQRSLHRSLQLKT-------ELPELPELTEPEPALVVWNTESPIEPKLSYEGDDI 121

  Fly   121 NEQFLTEVI-----AQQEQQTD------------SNPPKEQFIKEDNATVNDPETSATLPTEQRR 168
            .:..|.|.:     |..|:.:|            |.|.:|:          :||.....| ..|.
  Fly   122 KDHILCEPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEE----------EPEPDPVKP-RPRG 175

  Fly   169 ETRSTAKSKAHHSLPPSTPPEKS------------NSVANKSKAKRTPCKAE------------- 208
            ..|.||..:.|..:.......|.            .|.|.:.:.||:...||             
  Fly   176 RPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEE 240

  Fly   209 --------------------GTPQKSKRY-AD----------YKQCMLDIDAKISAHMRLTCDVC 242
                                |.|:..|.. ||          .:..:.::|..|:|:::|.|.:|
  Fly   241 DVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAIC 305

  Fly   243 HEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFADKQCL 307
            ....|.|..|.:|...||...||..|||.::.||:...||:..|.||:.|.|..|.|.|.::...
  Fly   306 AAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQ 370

  Fly   308 RNHELLKHHPEEEKTFMCEQCPKRYTKQYLLDQHRVIHK--ERNVVCDLCERRFPNQSLLCTHVK 370
            ..|.|..|..::|....|..|..|:.|::||..|...||  ||..|||.|.:.|..:..|..|||
  Fly   371 VMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVK 435

  Fly   371 MAHGNYGT--MCDICAQVIRGRAAFQRHQLE-HAGVTEPKVQCDICGSWHKNKHSLKKHVRRHN- 431
            ..|....|  :||||....|.:|.|..|:.. |......:|||.:||.|.:::.||:||:.||: 
  Fly   436 RMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDD 500

  Fly   432 ---GTAATCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYK 493
               .|...|.||.....:|:|:.||.|| |.:.::|:||:|:|.||....|.|||..|||..||:
  Fly   501 RDGDTKYRCLLCNAEKSSRAALSSHMRY-HHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQ 564

  Fly   494 CPHCPKTFNSNANQHTHRRKCHPKEF 519
            |..|.:||.|:||.|.|::|.||.::
  Fly   565 CQFCTRTFKSHANMHNHKKKMHPNDW 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 22/80 (28%)
C2H2 Zn finger 269..286 CDD:275368 6/16 (38%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 437..458 CDD:275368 9/20 (45%)
C2H2 Zn finger 466..486 CDD:275368 10/19 (53%)
C2H2 Zn finger 494..512 CDD:275368 9/17 (53%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 21/77 (27%)
C2H2 Zn finger 332..349 CDD:275368 6/16 (38%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 8/17 (47%)
C2H2 Zn finger 478..498 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..529 CDD:275368 9/20 (45%)
C2H2 Zn finger 537..557 CDD:275368 10/19 (53%)
C2H2 Zn finger 565..583 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C0KF
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.