DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and CG12219

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:615 Identity:127/615 - (20%)
Similarity:212/615 - (34%) Gaps:151/615 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLNNVNDTDTIRIF-------------EDVGLSL---NVANVLAKYFWFEPKSDDPISTV 49
            ||||||||.:::...:.:|             ||.|.::   .:..:::.:.:.....||.|||.
  Fly     1 MICRLCLNALDEQSAVLLFDGAGGASAPAPDDEDDGKAMPESYLVQLISIHLYLCLSRDDAISTC 65

  Fly    50 ICLTCWNQVNDFHQFYVAVESAHRLLTERFSLKSGQDQGKVEHGEDSEQQEE-----EQDEDQEL 109
            ||..|.:|:..||.|:..||.....|..:| |....|....|.|.:::...:     |..|:.::
  Fly    66 ICTECCSQLESFHNFWKLVELKQTTLCSQF-LAIDCDVNWSEDGSETQLDAQPQLLLEPAEEPKV 129

  Fly   110 GLPGSEG--------GSFTNEQFLTEVIAQQE-QQTDSNPPKEQFIKEDNATVNDPETSATLPTE 165
            ..|.:..        .||...::|.|.||... .:..:.|..|...:..:......::..|....
  Fly   130 VTPTTANKFPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKSKHTTQWL 194

  Fly   166 QRRETRSTAKSKAHHSLPPST-----------------PPEKSNSVAN--KSKAKRTPCKAEGTP 211
            :.||.|..|||..:|:.|..|                 .|..|.|..|  ...|..||. :..||
  Fly   195 KAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASPGNTVNPAATATPA-SSATP 258

  Fly   212 QKSKRYA------DYKQCMLD-IDAKISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICC 269
            ..:...|      ..:|..|. |.::.|..|.||                  :.:....|.....
  Fly   259 TTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLT------------------ITKTPPSGSRGSR 305

  Fly   270 NKKFYKRSFLTDHIDRHADPEKFKCTQ----CDKRFADKQCLRNHELLKHH-------------- 316
            |:...:::        |: |:|.:.|:    .|:....|:...|..:|.::              
  Fly   306 NRSSRRKT--------HS-PKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLT 361

  Fly   317 ---PEEEKTFMCEQCPKRYTKQYLLDQHRVIHKERNVVCDLCERRFPNQSLLCTHVKMAH--GNY 376
               |.:..:.....|.....:|:......|:.........:........:...|...|||  ||:
  Fly   362 GNPPGQPDSLQQRLCASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNH 426

  Fly   377 GTMCDICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGTAATCDLCG 441
                                         |..:.|      |...:..:.|......:..|..||
  Fly   427 -----------------------------PPSETD------KRPAAPLQAVIHAAPVSIICPNCG 456

  Fly   442 KVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNAN 506
            :        |..|.:..|:..|:.|.||.|:||....|.||...|||..|:.|..||..|.|.:|
  Fly   457 E--------LPGQNHRCLSKPKYACDVCGKSFKMKRYLEEHFATHTGVKLHTCAFCPTEFRSKSN 513

  Fly   507 QHTHRRKCHPKEFEEARKARTEKRKAIEEE 536
            .:.|.::.|..|:|.:|..|:..:..::|:
  Fly   514 MYHHTKRKHKAEWERSRATRSAAKAGVQEQ 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 26/91 (29%)
C2H2 Zn finger 269..286 CDD:275368 1/16 (6%)
C2H2 Zn finger 294..316 CDD:275368 5/25 (20%)
C2H2 Zn finger 325..345 CDD:275368 3/19 (16%)
C2H2 Zn finger 352..370 CDD:275368 1/17 (6%)
C2H2 Zn finger 410..430 CDD:275368 3/19 (16%)
C2H2 Zn finger 437..458 CDD:275368 5/20 (25%)
C2H2 Zn finger 466..486 CDD:275368 9/19 (47%)
C2H2 Zn finger 494..512 CDD:275368 7/17 (41%)
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 26/91 (29%)
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG4049 149..204 CDD:226535 10/54 (19%)
C2H2 Zn finger 168..186 CDD:275368 2/17 (12%)
C2H2 Zn finger 473..493 CDD:275370 9/19 (47%)
C2H2 Zn finger 501..522 CDD:275370 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.