DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and Zfp407

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_008770443.2 Gene:Zfp407 / 307213 RGDID:1310645 Length:2255 Species:Rattus norvegicus


Alignment Length:675 Identity:142/675 - (21%)
Similarity:214/675 - (31%) Gaps:242/675 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LKSGQDQGKVEHGEDSEQQEEEQDEDQELGLPGSEGGSFTNEQFLTEVIAQQEQQT-------DS 138
            ||..|....:|..|.....:.|.:...|...|.|.|.:..|:.:.|.:....:.||       ||
  Rat  1284 LKDVQANSNLESKEILMNSQHEPEVILEEDAPASIGTAENNDAYETIISIDDKGQTMYSFGRFDS 1348

  Fly   139 NPPKEQFIK-EDNATVNDPETSATLPTEQRRETRSTAKSKAHHSLPPSTPPEKSNSVANKSKAKR 202
            :..:   || ||...|..||                                 ...:....|...
  Rat  1349 SIIR---IKTEDGELVEQPE---------------------------------EGLMVTGGKVSE 1377

  Fly   203 TPCK--AEGTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFL----------LLCKH 255
            .|.|  |:|..:|....:.:.:           ..|:.||.|     .||          :..||
  Rat  1378 LPLKDCAQGLKKKKVEGSSFGE-----------STRIRCDDC-----GFLADGLSGLNVHIAMKH 1426

  Fly   256 MLQEHHRKGYAICCNKKFYKRSFLTDHI-------DRHADPEK-------FKCTQCDKRFADKQC 306
            ..:|.|  .:.:.|.|.||..|.|..|:       :..|..|:       |||.:|.:.|..:|.
  Rat  1427 PTKEKH--FHCLLCGKSFYTESNLHQHLASAGHMRNEQASVEELPEGGATFKCVKCTEPFDSEQN 1489

  Fly   307 L------RNHELLK-------------HHPEEE-------------------------------K 321
            |      ::.|||:             :...||                               |
  Rat  1490 LFLHIKGQHEELLREVNKYIVEDTEQINREREENQGNVCKYCGKMCRSSNSMAFLAHIRTHTGSK 1554

  Fly   322 TFMCEQC---------------------------------PKRYTKQYLLDQHRV-IHKERNVVC 352
            .|.|:.|                                 .|::...:||.:|.| ..|||...|
  Rat  1555 PFKCKICHFATAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGVGTPKERKFTC 1619

  Fly   353 DLCERRFPNQSLLCTHVKMAHGNYGTMC--DICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGS 415
            .||:|.|..:..|..|||:..|.....|  ..|.......:|.:.|...|.|  |....||:||.
  Rat  1620 HLCDRSFTEKWALNNHVKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRTHTG--EKSFLCDLCGF 1682

  Fly   416 WHKNKHSLKKHVRRHNGTAA-TCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITL 479
            ....:|:|.||.|:|.|... .||.|...|..:|.:..|:| ||..::.:.|..|:.....|..:
  Rat  1683 AGGTRHALTKHRRQHTGEKPFKCDECNFASTTQSHLTRHKR-VHTGEKPYRCPWCDYRSNCAENI 1746

  Fly   480 REHMTMHTGE----VLYKCPHCPKTFNSNANQHTHRRKCHP------------------------ 516
            |:|: :|||:    .:|.||.|....|.......|.::.||                        
  Rat  1747 RKHI-LHTGKHEGVKMYNCPKCDYGTNVPVEFRNHLKEQHPDIENPDLAYLHAGKQAELPSDVQG 1810

  Fly   517 ---KEFE----------------------------EARKARTEKRKAIEEETPSVLTISTGEDGE 550
               |.:|                            :.:..|:.||:|...|....:.|..|.|||
  Rat  1811 IVSKSYECRLKGQGATFVETDSPFTAATLAEESPVKEKSLRSSKRQASSPEQVQQVIIIQGYDGE 1875

  Fly   551 SHSILLTNTEEDIKGDTIEFTLCLS 575
               ..|..:.|:....|:: ||.::
  Rat  1876 ---FALDASVEETAAATLQ-TLAMA 1896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 7/23 (30%)
C2H2 Zn finger 294..316 CDD:275368 8/40 (20%)
C2H2 Zn finger 325..345 CDD:275368 7/53 (13%)
C2H2 Zn finger 352..370 CDD:275368 7/17 (41%)
C2H2 Zn finger 410..430 CDD:275368 9/19 (47%)
C2H2 Zn finger 437..458 CDD:275368 7/20 (35%)
C2H2 Zn finger 466..486 CDD:275368 5/19 (26%)
C2H2 Zn finger 494..512 CDD:275368 5/17 (29%)
Zfp407XP_008770443.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.