| Sequence 1: | NP_611362.2 | Gene: | CG15073 / 37155 | FlyBaseID: | FBgn0034379 | Length: | 580 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_491096.1 | Gene: | ztf-23 / 171880 | WormBaseID: | WBGene00021846 | Length: | 419 | Species: | Caenorhabditis elegans |
| Alignment Length: | 362 | Identity: | 79/362 - (21%) |
|---|---|---|---|
| Similarity: | 112/362 - (30%) | Gaps: | 138/362 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 264 GYAI---CCNKKFYKRSF--LTDHI-DRHADPEKFKCTQCD------------------------ 298
Fly 299 --------KRF----ADKQCL------------------------------------RNHELLKH 315
Fly 316 HPEEEKTF--------------------------------------------MCEQCPKRYTKQY 336
Fly 337 LLDQHRVIHKER---NVVCDLCERRFPNQSLLCTH-VKMAHG--NYGTM----CDICAQVIRGRA 391
Fly 392 AFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGTAA-TCDL-CGKVSPNRSAMLSHQ 454
Fly 455 RYVHLTDRKHECSVCNKAF-KKAITLREHMTMHTGEV 490 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15073 | NP_611362.2 | zf-AD | 2..78 | CDD:285071 | |
| C2H2 Zn finger | 269..286 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 294..316 | CDD:275368 | 9/93 (10%) | ||
| C2H2 Zn finger | 325..345 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 352..370 | CDD:275368 | 4/18 (22%) | ||
| C2H2 Zn finger | 410..430 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 437..458 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 466..486 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 494..512 | CDD:275368 | |||
| ztf-23 | NP_491096.1 | C2H2 Zn finger | 251..271 | CDD:275368 | 4/19 (21%) |
| zf-H2C2_2 | 264..288 | CDD:290200 | 8/25 (32%) | ||
| C2H2 Zn finger | 279..299 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 291..317 | CDD:290200 | 10/25 (40%) | ||
| C2H2 Zn finger | 307..328 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 324..344 | CDD:290200 | 6/19 (32%) | ||
| C2H2 Zn finger | 336..357 | CDD:275368 | 7/20 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||