DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15073 and Zfp91

DIOPT Version :9

Sequence 1:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_443735.2 Gene:Zfp91 / 109910 MGIID:104854 Length:572 Species:Mus musculus


Alignment Length:511 Identity:99/511 - (19%)
Similarity:186/511 - (36%) Gaps:124/511 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EQQTDSNPPKEQFIKEDNATVNDPETSATLPTEQRRETRSTAKSKAHHSLPPSTPPEKSNSVANK 197
            |:.|....|||:  |||::.:  |:..:...|...|..||::::    |:......|.:.|..:|
Mouse   120 EKLTTDKDPKEE--KEDDSVL--PQEVSITTTRASRSWRSSSRT----SISRLRDSENTRSSRSK 176

  Fly   198 SKAKRTPCKAEGTPQKSKRYADYKQCMLDIDAKISAHMRLTCDVCHEGQETFLLLCKHM-LQEHH 261
            :.:.:..||.|....:    .||     |:..:..:...::.|...|.:|..|:..:.: .::..
Mouse   177 TGSLQLVCKTEPITDQ----LDY-----DVPEEHQSPGGISSDEEEEEEEEMLISEEEIPFKDDP 232

  Fly   262 RKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHHPEEE------ 320
            |        .:.||     .|::|.....:.|..:..:....|:.....|:.....|.|      
Mouse   233 R--------DETYK-----PHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEE 284

  Fly   321 ---------KTFMCEQCPKRYTK--------------------QYLLDQHRVIHK---ERNVVC- 352
                     |.....:.|||..|                    :||  ||.:.::   ::..|| 
Mouse   285 PPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYL--QHHIKYQHLLKKKYVCP 347

  Fly   353 -DLCERRFPNQSLLCTHVKMAHGNYGTMCDICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSW 416
             ..|.|.|..|..|..|.|........:|:.||:..:.......|::.|.|  |..:||:|||..
Mouse   348 HPSCGRLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTG--EKPLQCEICGFT 410

  Fly   417 HKNKHSLKKHVRRHNGTA---ATCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAIT 478
            .:.|.||..|:::|:..:   .:|::|||....:.::::|:...|                ..:.
Mouse   411 CRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSH----------------PEVL 459

  Fly   479 LREHMTMHTGEVLYK-------------------CPHCPKTF-NSNANQHTHRRKCHPKEFEEAR 523
            :.|.:..:.|.::..                   .|..|:.. ||.|.:      |...|.|...
Mouse   460 IAEALAANAGALITSTDILGTNPEPLTQPADGQGLPLLPEPLGNSTAGE------CLLLEAEGMS 518

  Fly   524 KARTEKRKAIEEETPSVLTISTGEDGESHSILLTNTEEDIKGDTIEFTLCLSADTT 579
            |:.....:.:.......:.:.:|..|.:..:::.:   ||.|.|.| .|....|:|
Mouse   519 KSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNS---DILGATTE-VLIEDTDST 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 3/16 (19%)
C2H2 Zn finger 294..316 CDD:275368 2/21 (10%)
C2H2 Zn finger 325..345 CDD:275368 8/39 (21%)
C2H2 Zn finger 352..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 437..458 CDD:275368 5/20 (25%)
C2H2 Zn finger 466..486 CDD:275368 1/19 (5%)
C2H2 Zn finger 494..512 CDD:275368 5/18 (28%)
Zfp91NP_443735.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308 41/217 (19%)
zf-C2H2_8 315..392 CDD:292531 16/78 (21%)
Interaction with MAP3K14/NIK. /evidence=ECO:0000250 340..370 9/29 (31%)
C2H2 Zn finger 349..368 CDD:275368 7/18 (39%)
C2H2 Zn finger 376..396 CDD:275368 4/19 (21%)
zf-H2C2_2 388..413 CDD:290200 9/26 (35%)
C2H2 Zn finger 404..424 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..450 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.