DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and PRR1

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_012806.1 Gene:PRR1 / 853744 SGDID:S000001599 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:369 Identity:104/369 - (28%)
Similarity:161/369 - (43%) Gaps:85/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATTPTAGPAAAPPTSSTPQNY-KVP-------STSKIS--------VDKLLRVGYYELEKTIGK 49
            :.:.||....|....|....|| |.|       ||.|..        :|...|...::..:.||.
Yeast   136 VVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGS 200

  Fly    50 GNFAVVKL-----ATNIVTKTKVAIKII--DKTCLNEEYLNKTF--------------REIAILK 93
            |||:.|.|     .:|...| :||:|.:  .:...|.|.:|.:.              ||:.:||
Yeast   201 GNFSTVLLYELMDQSNPKLK-QVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLK 264

  Fly    94 SLRHPHITRLYEV-----MESQSMIY--------------LVTEYAPNGEIFDHLVA-NGRMKEP 138
            ||.||.|.:|..:     :.|:..:.              ::..|.|.|::...::| |||::..
Yeast   265 SLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAW 329

  Fly   139 EAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLD---KDMN-------------IKLADFGFSNH 187
            ...|:||::|.||.|.|...::|||||.||:||.   .|:|             |:|||||....
Yeast   330 LIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKK 394

  Fly   188 YEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFD--GKTILELKSRV 250
            .|........|||..|.:||:..|:.|||..||.|:|||:||:|....||||  .......:||.
Yeast   395 IENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRA 459

  Fly   251 VLGK--------FRIPFFMSQECEQLIRNMLVVEPDRRYTIKQI 286
            ...:        :|:..:.:...:|::.|.| ...::|::|.:|
Yeast   460 TSHRIARFDWRWYRLSDYKTNVGKQIVENTL-TRKNQRWSINEI 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 91/314 (29%)
S_TKc 41..292 CDD:214567 91/313 (29%)
UBA_SIK 335..380 CDD:270523
PRR1NP_012806.1 S_TKc 192..508 CDD:214567 91/313 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.