DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and SnRK1.3

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_198760.1 Gene:SnRK1.3 / 833940 AraportID:AT5G39440 Length:494 Species:Arabidopsis thaliana


Alignment Length:478 Identity:161/478 - (33%)
Similarity:243/478 - (50%) Gaps:104/478 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TSKISVDKLLRV-GYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLN-KTFREI 89
            :|:.:.:||:.: ..|.:.||:|.|:||.||||.::.|..||||||::::.:....:. |..|||
plant     4 SSEKTTNKLVSILPNYRIGKTLGHGSFAKVKLALHVATGHKVAIKILNRSKIKNMGIEIKVQREI 68

  Fly    90 AILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYC 154
            .||:.|.||||.|.|||:|:.:.||:|.||..:||:||::|..|:::|.||..:|.|::|.|.||
plant    69 KILRFLMHPHIIRQYEVIETPNDIYVVMEYVKSGELFDYIVEKGKLQEDEARHLFQQIISGVEYC 133

  Fly   155 HRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKS 219
            ||..:||||||.||||||...|||:.|||.||...:|..|||.||||.||||||..|..| ||..
plant   134 HRNMIVHRDLKPENVLLDSQCNIKIVDFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKPY-GPDV 197

  Fly   220 DIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIK 284
            ||||.||:||||:||.||||.:.|..:..::..|.:.:|..:|.....||..||:|:|..|.:|.
plant   198 DIWSCGVILYALLCGTLPFDDENIPNVFEKIKRGMYTLPNHLSHFARDLIPRMLMVDPTMRISIT 262

  Fly   285 QIIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLT 349
            :|.:|.|             |.:..|                ...|.|.||::.....::     
plant   263 EIRQHPW-------------FNNHLP----------------LYLSIPPLDTIDQAKKIE----- 293

  Fly   350 ADMIAQSVHEQRFDNIYAIYNLLHDKLQQRRRENQRLQHHASLAYS----------------RSR 398
             :.|.|:|....||..:.:.:|.:           |:|:.|::||.                :|:
plant   294 -EEIIQNVVNIGFDRNHVVDSLAN-----------RIQNEATVAYHLILDNRNQNSVPNDPFQSK 346

  Fly   399 KTSITTGVVDRSEPVKQESLDRLSPLSNANASSSALGFG----------WS----------DVAV 443
            ...|:.|:.:.:.||:..:       |:...|.||| :|          |:          |:..
plant   347 FKEISDGIFNSTLPVQNIT-------SHVGHSFSAL-YGLKSNVKDDKTWTLGLQSQGSPYDIMT 403

  Fly   444 DL-----------EKYGDFELEC 455
            ::           :|.|.:.::|
plant   404 EIFKALQNLKICWKKIGLYNIKC 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 124/252 (49%)
S_TKc 41..292 CDD:214567 124/251 (49%)
UBA_SIK 335..380 CDD:270523 7/44 (16%)
SnRK1.3NP_198760.1 STKc_AMPK_alpha 16..270 CDD:270981 125/267 (47%)
UBA_SnRK1_plant 292..332 CDD:270520 11/56 (20%)
AMPKA_C 388..491 CDD:213378 5/39 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.