DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and Smok3a

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_001119517.1 Gene:Smok3a / 545814 MGIID:3693943 Length:504 Species:Mus musculus


Alignment Length:435 Identity:137/435 - (31%)
Similarity:218/435 - (50%) Gaps:52/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GPAAAPPTSSTPQNYKVPSTSKISVDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKII 72
            ||      .|..::.|:.|.|.::....|...|..|| |||.|..|.||||.:.:|.|.||:|.|
Mouse     2 GP------GSQQKSEKLRSKSPLADMDGLHAQYVMLE-TIGHGGCATVKLAQHRLTGTHVAVKTI 59

  Fly    73 DKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKE 137
            .|   .|.:.|:...|:.:|....||:|..|.:|:|::..:||:.|......::.|:...|.::|
Mouse    60 RK---REYWCNRVISEVELLMMADHPNIISLLQVIETKKKVYLIMELCKGKSLYQHIRKAGYLQE 121

  Fly   138 PEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPP 202
            .||..:|.||:||::|||.:|:||||||.:|::::||..:|:.|||.....:.|..|..:||:.|
Mouse   122 HEARALFKQLLSAMNYCHNQGIVHRDLKPDNIMVEKDGKVKIIDFGLGTKVKPGQKLNLFCGTYP 186

  Fly   203 YAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQ 267
            ::||||.....|||||.|:|:||||||.:|.|.:|||..:|.:|..|::.||:.||..:|.|.:.
Mouse   187 FSAPEVLLSTPYDGPKIDVWTLGVVLYFMVTGKIPFDACSIKKLVKRILAGKYSIPSRLSAELQD 251

  Fly   268 LIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPP 332
            |:..::...|..|.|:.:::.|.|::|                |||.......       ..:|.
Mouse   252 LLSLLMTANPKLRPTVAEVMVHPWVTE----------------GSGVFPDPCE-------EQTPL 293

  Fly   333 QLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLH-------DKLQQRRRENQRLQHHA 390
            :.|..::..|..: |..|..|..|:.:::|:...|.|.||.       |:..:.|..|..:....
Mouse   294 KPDPAIVKAMGHI-GFQAQDIEDSLRQRKFNQTMASYCLLKKQILKECDRPTRARPVNPSVTPFP 357

  Fly   391 SLAYSRSRKTSITTGVVDRSEPVKQESLDRLSPLSNANASSSALG 435
            ||..:.:.:..:..   ..:||.        .|.|:||...|..|
Mouse   358 SLVDTATTRLGLRR---RENEPT--------CPWSSANRQVSVCG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 100/251 (40%)
S_TKc 41..292 CDD:214567 99/250 (40%)
UBA_SIK 335..380 CDD:270523 12/51 (24%)
Smok3aNP_001119517.1 STKc_AMPK-like 27..275 CDD:270905 100/251 (40%)
UBA_MARK_Par1 295..334 CDD:270522 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..421 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.