DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and RGD1560718

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:XP_038957446.1 Gene:RGD1560718 / 499027 RGDID:1560718 Length:501 Species:Rattus norvegicus


Alignment Length:347 Identity:112/347 - (32%)
Similarity:185/347 - (53%) Gaps:36/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYE 105
            |.:..|||.|..|.||||.:.:|.|.||:|::.|   .:::..:...|:.|:..:.||:|..|.:
  Rat    27 YLVLNTIGHGFHAAVKLAVHRLTGTPVAVKMLLK---RQQWCQQVTSEVEIMMRINHPNIVSLIQ 88

  Fly   106 VMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVL 170
            |::::.:.||:.|.|...:::..:...|.::|.||..:|.||:|||.|||:.|::|||||.:|:|
  Rat    89 VIDTEKITYLIMELAKGNQLYSRIKEAGHLQEDEARGIFRQLLSAVGYCHKEGIIHRDLKPDNIL 153

  Fly   171 LDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGA 235
            :|....||:.|||.:.....|..|:|..|:..::|||:|.|..|:|||.|:|:|||:||.:..|.
  Rat   154 VDTKGRIKIVDFGSATQVRPGQKLRTHYGTYAFSAPELFLGKFYEGPKVDVWALGVILYYMTVGK 218

  Fly   236 LPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQ 300
            |||:...:..|:.:||||.:..|..:|:|.:.|:..::.|...:|.||..::.|.|| :..||  
  Rat   219 LPFEAVRLPLLRRQVVLGTYAEPLGLSEELQDLLSLLMKVNSQQRPTIPDLLTHPWL-KIDSE-- 280

  Fly   301 EQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNI 365
                 |...|....:               |.:.|..::..|..: |..|..:..|:.:::|:..
  Rat   281 -----GFPQPCKELI---------------PLRPDPAILRAMQDI-GFEAQEVKDSLDQKKFNQS 324

  Fly   366 YAIYNLLHDKLQQRRRENQRLQ 387
            .|.|..|         |.|.||
  Rat   325 MACYYFL---------EKQALQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 92/250 (37%)
S_TKc 41..292 CDD:214567 92/250 (37%)
UBA_SIK 335..380 CDD:270523 9/44 (20%)
RGD1560718XP_038957446.1 STKc_AMPK-like 26..274 CDD:270905 92/249 (37%)
UBA_MARK_Par1 294..333 CDD:270522 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.