DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and CG17698

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:405 Identity:110/405 - (27%)
Similarity:190/405 - (46%) Gaps:68/405 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPTAGPAAAPPTSSTPQNYKVPSTSKISVDK---LLRVGYYELEKTIGKGNFAVVKLATNIVTKT 65
            :|.:.|.::|.:|.....::  .:.:||:||   .|::..|.|.:.||:|::.:||||.:....|
  Fly   245 SPYSTPFSSPRSSRRKPAFR--ESRRISIDKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDST 307

  Fly    66 KVAIKIIDKTCLNEEY-------------LNKTFREIAILKSLRHPHITRLYEVMES--QSMIYL 115
            ..|:||:.|..|..:.             |::.:||||:||.|.||::.:|.||::.  :..:|:
  Fly   308 HYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYM 372

  Fly   116 VTEYAPNGEIFDHLVANGRMKEPEAARVF----------TQLVSA--------VHYCHRRGVVHR 162
            |.|....||:. .:..:..:.|..|..:|          |.|.|:        |:..|.:.::|.
  Fly   373 VFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHA 436

  Fly   163 DLKAENVLLDKDMNIKLADFGFSNHY-EEGATLK--TWCGSPPYAAPE-VFQGL-EYDGPKSDIW 222
            |:|..|:||.:..::|:||.|..|.: .:.||:.  :..|:|.:.||| :..|. ||.|..:|:|
  Fly   437 DIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVW 501

  Fly   223 SLGVVLYALVCGALPF--DGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQ 285
            :||..||:|:.|.:||  |...:|..|.:....||.....:::..:..|..||...|.:|.||.|
  Fly   502 ALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQRITIPQ 566

  Fly   286 IIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGL-T 349
            :...:|::               |.|...:........|....|.  .:||||.:    :|.| |
  Fly   567 LKTSKWVT---------------SDGDYPLPTEEENCCLVQVDDE--DIDSVVRS----IPKLDT 610

  Fly   350 ADMIAQSVHEQRFDN 364
            ..:|...:.:..|.|
  Fly   611 LILIKTMLKKHSFGN 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 86/291 (30%)
S_TKc 41..292 CDD:214567 86/290 (30%)
UBA_SIK 335..380 CDD:270523 10/31 (32%)
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 86/290 (30%)
STKc_CAMKK 288..574 CDD:271020 85/286 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.