DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and CG14305

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:284 Identity:93/284 - (32%)
Similarity:154/284 - (54%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TSKISVDKLLRVGYYELEKTIGKGNFAVVKLATNIVTK---------TKVAIKIIDKTCLNEEYL 82
            |....||.|.:.| |.:...||:|::|.|      :|.         ..:|.|||||.....:::
  Fly    15 TRSSDVDALAQRG-YNVGHKIGEGSYATV------ITAGYADDHGHGVHLACKIIDKAKAPTDFV 72

  Fly    83 NKTF-REIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQ 146
            ||.| ||:.||..:.|.:|.:::.:::....|::...||.||::..|:..:|.:.|.::...|.|
  Fly    73 NKFFPRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQ 137

  Fly   147 LVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHY--EEGATLK--TWCGSPPYAAPE 207
            :..|:.|.|...:.|||||.||:||.|.:|||||||||:.:.  :.|..:|  |:|||..|||||
  Fly   138 MSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPE 202

  Fly   208 VFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILEL----KSRVVLGKFRIPFFMSQECEQL 268
            |..|..||...:|.|||||:|:.::...:|||...:.:|    ::|....:.::...:|.:.:..
  Fly   203 VVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKAT 267

  Fly   269 IRNMLVVEPDRRYTIKQIIKHRWL 292
            :..:|..|...|:.:::|:...||
  Fly   268 VSVLLEPEAHARWNLREILNCAWL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 86/269 (32%)
S_TKc 41..292 CDD:214567 86/268 (32%)
UBA_SIK 335..380 CDD:270523
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 87/270 (32%)
S_TKc 28..287 CDD:214567 86/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.